Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5K1 Olfactory Receptor

Gene Symbol OR5K11 (View this gene in GeneCards)
Family 5
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases HSHTPCRX10, OR3-8, HsOR3.3.16, ORL43
External Ids HGNC: 8349   GeneBank: AB065458, BK004416, HSHTPRX10, NM_001004736   ORDB: ORL43   
Build #39 labels OR5K1
Chromosomal location 3:98,469,577-98,470,500 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5K2 94.79% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5K1 87% 308
Chimp CONTIG405.199-846 99% 308
Chimp CONTIG405.207-1912 95% 307
Mouse Or5k1 85% 308
Mouse Or5k1b 82% 308
Rat Or5k1-ps 86% 308
Cow OR5K1 87% 308

Expression evidences

Source Accession
mRNA X64984
GNF Atlas2 gnf1h10536_at

Sequence information

Nucleotide sequence ATGGCTGAAGAAAATCATACCATGAAAAATGAGTTTATCCTCACAGGATTTACAGATCAC
CCTGAGCTGAAGACTCTGCTGTTTGTGGTGTTCTTTGCCATCTATCTGATCACCGTGGTG
GGGAATATTAGTTTGGTGGCACTGATATTTACACACCGTCGGCTTCACACACCAATGTAC
ATCTTTCTGGGAAATCTGGCTCTTGTGGATTCTTGCTGTGCCTGTGCTATTACCCCCAAA
ATGTTAGAGAACTTCTTTTCTGAGAACAAAAGGATTTCCCTCTATGAATGTGCAGTACAG
TTTTATTTTCTTTGCACTGTGGAAACTGCAGACTGCTTTCTTCTGGCAGCAATGGCCTAT
GACCGCTATGTGGCCATATGCAACCCACTGCAGTACCACATCATGATGTCCAAGAAACTC
TGCATTCAGATGACCACAGGGGCCTTCATAGCTGGAAACCTGCATTCCATGATTCATGTA
GGGCTTGTATTTAGGTTAGTTTTCTGTGGATCGAATCACATCAACCACTTTTACTGTGAT
ATTCTTCCCTTGTATAGACTCTCTTGTGTTGATCCTTATATCAATGAACTGGTTCTATTC
ATCTTCTCAGGTTCAGTTCAAGTCTTTACCATAGGTAGTGTCTTAATATCTTATCTCTAT
ATTCTTCTTACTATTTTCAAAATGAAATCCAAAGAGGGAAGGGCCAAAGCTTTTTCTACC
TGTGCATCCCACTTTTTGTCAGTTTCATTATTCTATGGATCTCTTTTCTTCATGTACGTT
AGACCAAATTTGCTTGAAGAAGGGGATAAAGATATACCAGCTGCAATTTTATTTACAATA
GTAGTTCCCTTACTAAATCCTTTCATTTATAGCCTGAGAAATAGGGAAGTAATAAGTGTC
TTAAGAAAAATTCTGATGAAGAAA
Conceptual translation MAEENHTMKNEFILTGFTDHPELKTLLFVVFFAIYLITVVGNISLVALIFTHRRLHTPMY
IFLGNLALVDSCCACAITPKMLENFFSENKRISLYECAVQFYFLCTVETADCFLLAAMAY
DRYVAICNPLQYHIMMSKKLCIQMTTGAFIAGNLHSMIHVGLVFRLVFCGSNHINHFYCD
ILPLYRLSCVDPYINELVLFIFSGSVQVFTIGSVLISYLYILLTIFKMKSKEGRAKAFST
CASHFLSVSLFYGSLFFMYVRPNLLEEGDKDIPAAILFTIVVPLLNPFIYSLRNREVISV
LRKILMKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 98,188,616 98,188,615 Ins(1) -/G rs34478238 (DbSNP)
3 98,189,074 98,189,074 nonsense SNP A/T */Y rs73140291 (DbSNP)
3 98,188,577 98,188,577 NS C/T R/C rs62619937 (DbSNP)
3 100 -100 SYN C/T A/A 1000GP (YRI)
3 100 -100 NS T/C V/A 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q143R V198I V282A % Freq CORP
1 Q V V 98.69 0.144
2 Q V A 0.77 0.144
3 R V V 0.46 0.144
4 Q I V 0.08 0.144

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5K1.aApr07-unspliced main_exon CDS chr3 98,469,577 98,470,500 +
3UTR chr3 98,470,500 98,470,528 +