Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5K2 Olfactory Receptor

Gene Symbol OR5K21 (View this gene in GeneCards)
Family 5
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.27 (functional)
Aliases OR3-9, HsOR3.3.17, ORL3095
External Ids HGNC: 14774   GeneBank: AB065457, BK004415, NM_001004737   ORDB: ORL3095   
Build #39 labels OR5K2
Chromosomal location 3:98,497,681-98,498,628 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5K1 94.79% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5K1 83% 316
Chimp CONTIG405.207-1912 97% 316
Chimp CONTIG405.199-846 94% 307
Mouse Or5k1 83% 307
Rat Or5k1-ps 83% 307
Cow OR5K1 83% 316

Expression evidences

Source Accession
ESTs DA427661
mRNA BC136724

Sequence information

Nucleotide sequence ATGGTTGAAGAAAATCATACCATGAAAAATGAGTTTATCCTCACAGGATTTACAGATCAC
CCTGAGCTGAAGACTCTGCTGTTTGTGGTGTTCTTTGCCATCTATCTGATCACCGTGGTG
GGGAATATTAGTTTGGTGGCACTGATATTTACACACTGTCGGCTTCACACACCAATGTAC
ATCTTTCTGGGAAATCTGGCTCTTGTGGATTCTTGCTGTGCCTGTGCTATTACCCCCAAA
ATGTTAGAGAACTTCTTTTCTGAGGGCAAAAGGATTTCCCTCTATGAATGTGCAGTACAG
TTTTATTTTCTTTGCACTGTGGAAACTGCAGACTGCTTTCTTCTGGCAGCAGTGGCCTAT
GACCGCTATGTGGCCATCTGCAACCCACTGCAGTACCACATCATGATGTCCAAGAAACTC
TGCATTCAGATGACCACAGGCGCCTTCATAGCTGGAAATCTGCATTCCATGATTCATGTA
GGGCTTGTATTTAGGTTAGTTTTCTGTGGATTGAATCACATCAACCACTTTTACTGTGAT
ACTCTTCCCTTGTATAGACTCTCCTGTGTTGACCCTTTCATCAATGAACTGGTTCTATTC
ATCTTCTCAGGTTCAGTTCAAGTCTTTACCATAGGTAGTGTCTTAATATCTTATCTCTAT
ATTCTTCTTACTATTTTCAGAATGAAATCCAAGGAGGGAAGGGCCAAAGCCTTTTCTACT
TGTGCATCCCACTTTTCATCAGTTTCATTATTCTATGGATCTATTTTTTTCCTATACATT
AGACCAAATTTGCTTGAAGAAGGAGGTAATGATATACCAGCTGCTATTTTATTTACAATA
GTAGTTCCCTTACTAAATCCTTTCATTTATAGTCTGAGAAACAAGGAAGTAATAAGTGTC
TTAAGAAAAATTCTGCTGAAAATAAAATCTCAAGGAAGTGTGAACAAA
Conceptual translation MVEENHTMKNEFILTGFTDHPELKTLLFVVFFAIYLITVVGNISLVALIFTHCRLHTPMY
IFLGNLALVDSCCACAITPKMLENFFSEGKRISLYECAVQFYFLCTVETADCFLLAAVAY
DRYVAICNPLQYHIMMSKKLCIQMTTGAFIAGNLHSMIHVGLVFRLVFCGLNHINHFYCD
TLPLYRLSCVDPFINELVLFIFSGSVQVFTIGSVLISYLYILLTIFRMKSKEGRAKAFST
CASHFSSVSLFYGSIFFLYIRPNLLEEGGNDIPAAILFTIVVPLLNPFIYSLRNKEVISV
LRKILLKIKSQGSVNK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 98,217,178 98,217,178 nonsense SNP A/T */Y rs55639376 (DbSNP)
3 98,217,050 98,217,050 NS A/C N/H rs59427166 (DbSNP)
3 98,217,368 98,217,368 NS C/G L/V rs61733537 (DbSNP)
3 98,216,681 98,216,681 NS C/T R/C rs1729959 (DbSNP)
3 98,217,154 98,217,154 SYN C/T T/T rs58947289 (DbSNP)
3 100 -100 NS C/A H/N 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L115V R122H T146S H176N Y218* % Freq CORP
1 L R T H Y 85.71 0.402
2 L R T H * 11.83 1.200
3 L R T N Y 1.84 0.510
4 V R T H Y 0.23 0.402
5 L H T H Y 0.23 0.923
6 L H T H * 0.08 1.200
7 L R S H * 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5K2.aApr07-unspliced main_exon CDS chr3 98,497,681 98,498,628 +
3UTR chr3 98,498,628 98,498,631 +