Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5K3 Olfactory Receptor

Gene Symbol OR5K31 (View this gene in GeneCards)
Family 5
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases HsOR3.3.15
External Ids HGNC: 31290   GeneBank: NM_001005516   
Build #39 labels OR5K3
Chromosomal location 3:98,390,666-98,391,628 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5K1 74.35% 308
OR5K2 72.17% 309
OR5K4 75.24% 319

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5K1 77% 322
Chimp CONTIG405.188-5032 97% 321
Mouse Or5k3 81% 308
Rat Or5k3 81% 308
Cow OR5K8 80% 307

Sequence information

Nucleotide sequence ATGAATAAGGAGAATCACTCCTTGATAGCTGAGTTCATCCTCACAGGATTTACATATCAT
CCAAAGCTGAAGACTGTTCTGTTTGTGGTGTTCTTTGCCATCTATCTGATCACCATGGTG
GGGAACATTGGTTTGGTGGCATTGATTTATATAGAGCAACGTCTTCACACACCAATGTAC
ATATTTTTAGGCAACCTAGTTCTGATGGATTCCTGCTGTTCCTCTGCTATTACTCCCAAG
ATGTTAGAGAACTTCTTTTCTGAGGACAAAAGGATTACCCTGTATGAATGTATGGCACAA
TTTTATTTTCTCTGTCTTGCTGAAACTACAGACTGCTTTCTTCTGGCGGCAATGGCCTAT
GACTGCTATGTGGCCATATGCAACCCACTGCAGTACCACACCATGATGTCCAAGACACTC
TGCATTCAGATGACTGCAGGAGCCTACCTAGCTGGCAACCTGCATCCCATGATTGAAGTA
GAGTTTCTGTTGAGGTTAACTTTCTGTGGGTCTCATCAAATCAATCATTTTTTCTGTGAT
GTTCTTCCATTATATAGACTTTCTTGTATTAACCCTTATATCAATGAATTGGTGTTATTT
ATCTTGGCAGGATCAATTCAAATCTTTACTATAGTCTTAGTTTCTTATTTCTACATCCTT
TTCACAATATTTACAATGAAATCCAAGGAGGGAAGAGGCAAAGCTTTATCTACTTGTGCA
TCTCACTTTCTCTCTGTGTCAATATTCTGTGATTCCCTTCTCTTCATGTATGCTCGACCA
GGTGCAGTTAATGAAGGGGATAAAGATATACCTGTTGCTATATTTTATACTTTAGTTATT
CCTTTATTAAATCCTTTTATTTATAGCCTAAGAAATAAGGAAGTAATAAATATTATGAAA
AAAATTATGAAGAAGAGAAAATTTTGTCACATTCTGAAACAAATGTCATCCCCTCTGGCA
ACT
Conceptual translation MNKENHSLIAEFILTGFTYHPKLKTVLFVVFFAIYLITMVGNIGLVALIYIEQRLHTPMY
IFLGNLVLMDSCCSSAITPKMLENFFSEDKRITLYECMAQFYFLCLAETTDCFLLAAMAY
DCYVAICNPLQYHTMMSKTLCIQMTAGAYLAGNLHPMIEVEFLLRLTFCGSHQINHFFCD
VLPLYRLSCINPYINELVLFILAGSIQIFTIVLVSYFYILFTIFTMKSKEGRGKALSTCA
SHFLSVSIFCDSLLFMYARPGAVNEGDKDIPVAIFYTLVIPLLNPFIYSLRNKEVINIMK
KIMKKRKFCHILKQMSSPLAT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 98,110,075 98,110,075 NS A/G Y/C rs62268325 (DbSNP)
3 98,109,640 98,109,640 NS A/G D/G rs13068323 (DbSNP)
3 98,110,306 98,110,306 NS C/G A/G rs73854831 (DbSNP)
3 98,110,038 98,110,038 NS C/T L/F rs73854830 (DbSNP)
3 98,109,709 98,109,709 NS C/T A/V rs58422508 (DbSNP)
3 98,109,873 98,109,873 NS C/T R/C rs57067643 (DbSNP)
3 98,390,796 98,390,796 NS G/A G/D 1000GP (CEU, CHBJPT)
3 100 -100 NS C/T S/F 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
3 100 -100 SYN C/T S/S 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S7F L36P G44D V67A C122R F177L P260S G266A % Freq CORP
1 S L G V C F P G 74.73 0.026
2 S L D V C F P G 17.28 0.026
3 S L G A R L P G 4.76 0.019
4 S L G A R L P A 1.54 0.019
5 F P G V C F S G 1.31 0.026
6 S P G V R L P G 0.08 0.002
7 S L G V R L P G 0.08 0.002
8 S L D A C L P G 0.08 0.260
9 F P G V C L S G 0.08 0.026
10 F P G V C F P G 0.08 0.026

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5K3.aApr07-unspliced main_exon CDS chr3 98,390,666 98,391,628 +
3UTR chr3 98,391,628 98,391,631 +