Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5K4 Olfactory Receptor

Gene Symbol OR5K41 (View this gene in GeneCards)
Family 5
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.13 (functional)
Aliases HsOR3.3.14
External Ids HGNC: 31291   GeneBank: NM_001005517   
Build #39 labels OR5K4
Chromosomal location 3:98,353,854-98,354,816 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5K1 75.41% 305
OR5K2 72.46% 305
OR5K3 75.24% 319

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5K4 85% 309
Chimp CONTIG405.188-5032 76% 319
Chimp CONTIG405.182-29793 97% 243
Mouse Or5k14 79% 307
Rat Or5k17 78% 311
Cow OR5K8 78% 307
Cow OR5K19P 81% 212

Sequence information

Nucleotide sequence ATGGCTAGGGAAAATCACTCCTTAGCAGCTGAATTCATCCTCATAGGATTTACAAATTAT
CCAGAGCTGAAGACGCTTCTGTTTGTGGTGTTCTCTGCCATCTATCTGGTCACCATGGTG
GGGAATCTTGGTCTGGTGGCATTAATTTATGTAGAGCGTCGTCTTCTCACACCAATGTAC
ATCTTTCTGGGCAACCTGGCTCTGATGGATTCCTGCTGTTCCTGTGCTGTTACCCCCAAG
ATGTTAGAGAATTTCTTTTCTGAGGATAGAATTATTTCCCTGTATGAATGTATGGCACAA
TTTTATTTTCTCTGTCTTGCTGAAACCACAGACTGCTTTCTTCTGGCGACAATGGCCTAT
GACCGCTATGTGGCCATATGCCACCCACTGCAGTACCACACCATGATGTCCAAGACGCTC
TGCATTCGGATGACCACAGGGGCCTTCAAAGCTGGAAACCTGCATTCCATGATTCATGTA
GGGCTTTTATTAAGGTTAACTTTCTGCAGGTCTAATAAAATTCACCACTTTTTCTGTGAT
ATTCTTCCACTGTATAGACTCTCCTGTACAGATCCTTCTATTAATGAACTAATGATATAT
ATCTTTTCAATACCAATTCAAATCTTTACCATTGCTACTGTCTTGATCTCTTATCTCTGC
ATCCTTTTGACTGTTTTCAAAATGAAATCCAAGGAGGGAAGAGGTAAAGCATTTTCTACC
TGTGCATCCCACTTTCTCTCTGTCTCAATATTTTACATTTGTCTTCTCATGTATATTGGA
CCATCTGAAGAAGGAGATAAAGATACACCAGTGGCAATATTTTATGCAATAGTAATCCCA
TTACTAAACCCTTTTATTTATAGTCTGAGAAATAAGGAGGTCATAAATGTTCTTAAAAAA
ATTATGAGGAATTATAACATTCTTAAACAAACTTGCTCTATAGCAAATTTATTTTTAATT
TAT
Conceptual translation MARENHSLAAEFILIGFTNYPELKTLLFVVFSAIYLVTMVGNLGLVALIYVERRLLTPMY
IFLGNLALMDSCCSCAVTPKMLENFFSEDRIISLYECMAQFYFLCLAETTDCFLLATMAY
DRYVAICHPLQYHTMMSKTLCIRMTTGAFKAGNLHSMIHVGLLLRLTFCRSNKIHHFFCD
ILPLYRLSCTDPSINELMIYIFSIPIQIFTIATVLISYLCILLTVFKMKSKEGRGKAFST
CASHFLSVSIFYICLLMYIGPSEEGDKDTPVAIFYAIVIPLLNPFIYSLRNKEVINVLKK
IMRNYNILKQTCSIANLFLIY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 98,073,592 98,073,592 Del(1) -/A rs11288615 (DbSNP)
3 98,073,313 98,073,313 NS A/G I/V rs9822460 (DbSNP)
3 98,354,008 98,354,008 NS A/C E/A 1000GP (CEU)
3 98,354,118 98,354,118 NS G/A D/N 1000GP (CEU)
3 98,354,469 98,354,469 NS A/G I/V 1000GP (CEU, CHBJPT)
3 100 -100 NS C/A H/Q 1000GP (YRI, YRI, YRI)
3 100 -100 SYN G/A R/R 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H6Q Y20F E52A D89N Y123F I206V A242S I314V % Freq CORP
1 H Y E D Y I A I 74.58 0.144
2 H Y E D Y V A I 20.97 0.144
3 Q Y E D Y I A I 2.38 0.144
4 H Y E N Y I A I 0.61 0.144
5 H Y E D Y I A V 0.46 0.144
6 H Y E D Y I S I 0.31 0.144
7 H F E D Y I A I 0.31 0.144
8 H Y A D Y I A I 0.23 0.144
9 H Y E D F I A I 0.08 0.144
10 H Y E D F V A I 0.08 0.144

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5K4.aApr07-unspliced main_exon CDS chr3 98,353,854 98,354,816 +
3UTR chr3 98,354,816 98,354,819 +