Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5L1 Olfactory Receptor

Gene Symbol OR5L11 (View this gene in GeneCards)
Family 5
Subfamily L
Pseudogene No
CORP pseudogene probability score
Aliases OR11-151, OST262, HsOR11.11.28, ORL3396
External Ids HGNC: 8350   GeneBank: AB065780, BK004332, NM_001004738   ORDB: ORL3396   
Build #39 labels OR5L1
Chromosomal location 11:55,811,467-55,812,399 (+)
Cluster 11@56
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs12790505)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5L2 92.28% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5L1 83% 311
Dog OR5L1C 82% 311
Dog OR5L1B 81% 308
Chimp CONTIG970.44-6293 99% 311
Mouse Or5l14 80% 311
Rat Or5l14 78% 311
Cow OR5L1C 77% 309

Expression evidences

Source Accession
mRNA BC109250

Sequence information

Nucleotide sequence ATGGGCAAGGAAAACTGCACCACTGTGGCTGAGTTCATTCTCCTTGGACTATCAGATGTC
CCTGAGTTGAGAGTCTGCCTCTTCCTGCTGTTCCTTCTCATCTATGGAGTCACGTTGTTA
GCCAACCTGGGCATGATTGCACTGATTCAGGTCAGCTCTCGGCTCCACACCCCCATGTAC
TTTTTCCTCAGCCACTTGTCCTCTGTAGATTTCTGCTACTCCTCAATAATTGTGCCAAAA
ATGTTGGCTAATATCTTTAACAAGGACAAAGCCATCTCCTTCCTAGGGTGCATGGTGCAA
TTCTACTTGTTTTGCACTTGTGTGGTCACTGAGGTCTTCCTGCTGGCCGTGATGGCCTAT
GACCGCTTTGTGGCCATCTGTAACCCTTTGCTATACACAGTCACCATGTCTTGGAAGGTG
CGTGTGGAGCTGGCTTCTTGCTGCTACTTCTGTGGGACGGTGTGTTCTCTGATTCATTTG
TGCTTAGCTCTTAGGATCCCCTTCTATAGATCTAATGTGATTAACCACTTTTTCTGTGAT
CTACCTCCTGTCTTAAGTCTTGCTTGCTCTGATATCACTGTGAATGAGACACTGCTGTTC
CTGGTGGCCACTTTGAATGAGAGTGTTACCATCATGATCATCCTCACCTCCTACCTGCTA
ATTCTCACCACCATCCTGAAGATGGGCTCTGCAGAGGGCAGGCACAAAGCCTTCTCCACC
TGTGCTTCCCACCTCACAGCTATCACTGTCTTCCATGGAACAGTCCTTTCCATTTATTGC
AGGCCCAGTTCAGGCAATAGTGGAGATGCTGACAAAGTGGCCACCGTGTTCTACACAGTC
GTGATTCCTATGCTGAACTCTGTGATCTACAGCCTGAGAAATAAAGATGTGAAAGAAGCT
CTCAGAAAAGTGATGGGCTCCAAAATTCACTCC
Conceptual translation MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSRLHTPMY
FFLSHLSSVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYTVTMSWKVRVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD
LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST
CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNSVIYSLRNKDVKEA
LRKVMGSKIHS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,579,783 55,579,783 NS A/G M/V rs61735738 (DbSNP)
11 55,579,291 55,579,291 NS A/G M/V rs59122940 (DbSNP)
11 55,579,078 55,579,078 NS A/T I/F rs2869020 (DbSNP)
11 55,579,868 55,579,868 NS C/T T/I rs61732350 (DbSNP)
11 55,579,102 55,579,102 NS C/T R/W rs34961497 (DbSNP)
11 55,579,801 55,579,801 NS C/T P/S rs12790505 (DbSNP)
11 55,579,092 55,579,092 NS G/T Q/H rs61998198 (DbSNP)
11 55,579,419 55,579,419 SYN C/T H/H rs34948392 (DbSNP)
11 55,578,987 55,578,987 SYN C/T L/L rs67727364 (DbSNP)
11 55,578,991 55,578,991 SYN C/T L/L rs66537410 (DbSNP)
11 55,811,943 55,811,943 SYN T/C H/H 1000GP (CEU, CHBJPT)
11 55,812,325 55,812,325 NS T/C S/P 1000GP (CEU, CHBJPT)
11 55,811,626 55,811,626 NS C/T R/W 1000GP (CEU, CHBJPT)
11 100 -100 NS A/T I/F 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN T/C H/H 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,463,782 55,584,109 CopyNumber Variation_48056 (DGV)
11 55,437,126 55,596,313 CopyNumber Variation_48840 (DGV)
11 55,442,368 55,596,313 CopyNumber Variation_48841 (DGV)
11 55,444,868 55,591,047 CopyNumber Variation_48842 (DGV)
11 55,444,868 55,596,313 CopyNumber Variation_48843 (DGV)
11 55,447,427 55,596,313 CopyNumber Variation_53429 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,560,070 55,602,798 CopyNumber Variation_85785 (DGV)
11 55,578,843 55,581,875 Deletion #290 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I46F R54W T153M V281M S287P % Freq CORP
1 I R T V S 85.71 0.595
2 I W T V P 9.37 0.040
3 F R T V S 2.53 0.595
4 I R T V P 1.23 0.040
5 I R T M S 0.54 0.595
6 I W T V S 0.46 0.595
7 I R M V S 0.08 0.595
8 I W M V P 0.08 0.040

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5L1.aApr07-unspliced main_exon CDS chr11 55,811,467 55,812,399 +
3UTR chr11 55,812,399 55,812,402 +