Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5L2 Olfactory Receptor

Gene Symbol OR5L21 (View this gene in GeneCards)
Family 5
Subfamily L
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR11-153, HSHTPCRX16, HsOR11.11.30, ORL49
External Ids HGNC: 8351   GeneBank: AB065782, AF399526, BK004396, HSHTPRX16, NM_001004739   ORDB: ORL49   
Build #39 labels OR5L2
Chromosomal location 11:55,827,219-55,828,151 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5L1 92.28% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5L1 82% 311
Dog OR5L1C 81% 311
Dog OR5L1B 80% 308
Chimp CONTIG970.43-1162 98% 311
Mouse Or5l14 78% 311
Rat Or5l14 77% 311
Cow OR5L1C 77% 309

Expression evidences

Source Accession
mRNA BC172290
GNF Atlas2 gnf1h05453_s_at

Sequence information

Nucleotide sequence ATGGGCAAGGAAAACTGCACCACTGTGGCTGAGTTCATTCTCCTTGGACTATCAGATGTC
CCTGAGTTGAGAGTCTGCCTCTTCCTGCTGTTCCTTCTCATCTATGGAGTCACGTTGTTA
GCCAATCTGGGCATGACTGCACTGATTCAGGTCAGCTCTCGGCTCCACACCCCCGTGTAC
TTTTTCCTCAGCCACTTGTCCTTTGTAGATTTCTGCTACTCCTCAATAATTGTGCCAAAG
ATGTTGGCTAATATCTTTAACAAGGACAAAGCCATCTCCTTCCTAGGGTGCATGGTGCAA
TTCTACTTGTTTTGCACATGTGGAGTCACTGAGGTCTTCCTGCTGGCCGTGATGGCCTAT
GACCGCTTTGTGGCCATCTGTAACCCCCTGCTGTACATGGTGACCATGTCTCAGAAGCTG
CGTGTGGAGCTGACCTCTTGCTGCTACTTCTGTGGGACGGTGTGTTCTCTGATTCACTCG
TCCTTAGCTCTTAGGATCCTCTTCTATAGATCTAATGTGATTAACCACTTCTTCTGTGAT
CTACCCCCTCTCCTAAGTCTTGCTTGCTCTGATGTCACTGTGAATGAGACACTGCTGTTC
CTGGTGGCCACTTTGAATGAGAGTGTTACCATCATGATCATCCTCACCTCCTACCTGCTA
ATTCTCACCACTATCCTGAAGATACACTCTGCAGAGAGCAGGCACAAAGCTTTCTCCACC
TGTGCCTCCCACCTCACAGCCATCACTGTCTCCCATGGAACAATCCTTTACATTTATTGC
AGGCCGAGTTCAGGCAACAGTGGAGATGTTGACAAAGTGGCCACCGTGTTCTACACAGTT
GTGATTCCCATGCTGAACCCCCTGATCTACAGCCTGAGAAATAAGGATGTGAACAAAGCT
CTCAGAAAAGTGATGGGCTCCAAAATTCACTCC
Conceptual translation MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMTALIQVSSRLHTPVY
FFLSHLSFVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCGVTEVFLLAVMAY
DRFVAICNPLLYMVTMSQKLRVELTSCCYFCGTVCSLIHSSLALRILFYRSNVINHFFCD
LPPLLSLACSDVTVNETLLFLVATLNESVTIMIILTSYLLILTTILKIHSAESRHKAFST
CASHLTAITVSHGTILYIYCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKA
LRKVMGSKIHS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,595,116 55,595,116 Del(1) -/G rs35214936 (DbSNP)
11 55,595,113 55,595,112 Ins(1) -/T rs35119440 (DbSNP)
11 55,590,724 55,590,724 large insertion 9868bp insertion rs71769123 (DbSNP)
11 55,595,018 55,595,019 mnp TC/CA rs34954823 (DbSNP)
11 55,594,869 55,594,869 NS A/G M/V rs56711116 (DbSNP)
11 55,595,115 55,595,115 NS C/A R/S rs71490506 (DbSNP)
11 55,595,593 55,595,593 NS C/T A/V rs61743566 (DbSNP)
11 55,594,936 55,594,936 NS G/T R/M rs17148058 (DbSNP)
11 55,595,018 55,595,018 SYN A/G G/G rs61745634 (DbSNP)
11 55,595,012 55,595,012 SYN A/T T/T rs35645945 (DbSNP)
11 55,595,324 55,595,324 SYN C/T T/T rs7102663 (DbSNP)
11 55,595,081 55,595,081 SYN C/T P/P rs7102394 (DbSNP)
11 55,594,724 55,594,724 SYN G/T A/A rs61743527 (DbSNP)
11 55,595,114 55,595,114 SYN G/T L/L rs34929168 (DbSNP)
11 55,827,639 55,827,639 NS C/T R/C 1000GP (CEU)
11 55,827,542 55,827,542 SYN A/G G/G 1000GP (CEU)
11 55,827,638 55,827,638 SYN G/T L/L 1000GP (CEU)
11 55,827,393 55,827,393 NS G/A V/M 1000GP (CEU)
11 55,827,605 55,827,605 SYN C/T P/P 1000GP (CEU)
11 55,827,640 55,827,640 NS G/C R/P 1000GP (CEU)
11 55,827,536 55,827,536 SYN A/T T/T 1000GP (CEU)
11 55,827,541 55,827,541 NS G/T G/V 1000GP (CEU)
11 100 -100 NS A/G M/V 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T P/P 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,590,724 55,600,592 CopyNumber Variation_5629 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,437,126 55,596,313 CopyNumber Variation_48840 (DGV)
11 55,442,368 55,596,313 CopyNumber Variation_48841 (DGV)
11 55,444,868 55,596,313 CopyNumber Variation_48843 (DGV)
11 55,447,427 55,596,313 CopyNumber Variation_53429 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,560,070 55,602,798 CopyNumber Variation_85785 (DGV)
11 55,594,595 55,597,627 Deletion #292 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M45V V59M M81R R141H A300V G306D % Freq CORP
1 M V M R A G 85.94 0.279
2 M M M R A G 9.68 0.044
3 M V R R A G 2.69 0.279
4 M M M R V G 0.46 0.044
5 V V M H A G 0.38 0.142
6 M M R R A G 0.31 0.044
7 M M M R A D 0.23 0.044
8 M V M H A G 0.15 0.279
9 M V M R V G 0.15 0.279

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5L2.aApr07-unspliced main_exon CDS chr11 55,827,219 55,828,151 +
3UTR chr11 55,828,151 55,828,154 +