Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M1 Olfactory Receptor

Gene Symbol OR5M11 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-208, OST050, HsOR11.11.79, ORL3400
External Ids HGNC: 8352   GeneBank: AB065742, AF399522, BK004402, NM_001004740   ORDB: ORL3400   
Build #39 labels OR5M1
Chromosomal location 11:56,612,558-56,613,502 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M10 95.56% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M10 86% 315
Dog OR5M10C 86% 315
Mouse Or5m10 83% 307
Rat Or5m10b 82% 315
Rat Or5m10 84% 304
Cow OR5M10C 84% 306
Cow OR5M10 84% 306
Orang OR5E1P 52% 310
Horse OR5M10E 85% 315
Horse OR5M10 83% 315
Chimp OR5M10 95% 315

Sequence information

Nucleotide sequence ATGTTCTCCCCAAACCACACCATAGTGACAGAATTCATTCTCTTGGGACTGACAGACGAC
CCAGTGCTAGAGAAGATCCTGTTTGGGGTATTCCTTGCGATCTACCTAATCACACTGGCA
GGCAACCTGTGCATGATCCTGCTGATCAGGACCAATTCCCACCTGCAAACACCCATGTAT
TTCTTCCTTGGCCACCTCTCCTTTGTAGACATTTGCTATTCTTCCAATGTTACTCCAAAT
ATGCTGCACAATTTCCTCTCAGAACAGAAGACCATCTCCTACGCTGGATGCTTCACACAG
TGTCTTCTCTTCATCGCCCTGGTGATCACTGAGTTTTACATCCTTGCTTCAATGGCATTG
GATCGCTATGTAGCCATTTGCAGCCCTTTGCATTACAGTTCCAGGATGTCCAAGAACATC
TGTGTCTGTCTGGTCACTATCCCTTACATGTATGGGTTTCTTAGTGGGTTCTCTCAGTCA
CTGCTAACCTTTCACTTATCCTTCTGTGGCTCCCTTGAAATCAATCATTTCTACTGCGCT
GATCCTCCTCTTATCATGCTGGCCTGCTCTGACACCCGTGTCAAAAAGATGGCAATGTTT
GTAGTTGCAGGCTTTAATCTCTCAAGCTCTCTCTTCATCATTCTTCTGTCCTATCTTTTC
ATTTTTGCAGCGATCTTCAGGATCCGTTCTGCTGAAGGCAGGCACAAAGCCTTTTCTACG
TGTGCTTCCCACCTGACAATAGTCACTTTGTTTTATGGAACCCTCTTCTGCATGTACGTA
AGGCCTCCATCAGAGAAGTCTGTAGAGGAGTCCAAAATAACTGCAGTCTTTTATACTTTT
TTGAGCCCAATGCTGAACCCATTGATCTATAGCCTACGGAACACAGATGTAATCCTTGCC
ATGCAACAAATGATTAGGGGAAAATCCTTTCATAAAATTGCAGTT
Conceptual translation MFSPNHTIVTEFILLGLTDDPVLEKILFGVFLAIYLITLAGNLCMILLIRTNSHLQTPMY
FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYILASMAL
DRYVAICSPLHYSSRMSKNICVCLVTIPYMYGFLSGFSQSLLTFHLSFCGSLEINHFYCA
DPPLIMLACSDTRVKKMAMFVVAGFNLSSSLFIILLSYLFIFAAIFRIRSAEGRHKAFST
CASHLTIVTLFYGTLFCMYVRPPSEKSVEESKITAVFYTFLSPMLNPLIYSLRNTDVILA
MQQMIRGKSFHKIAV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/T L/Q 1000GP (YRI)
11 56,380,134 56,380,134 NS C/G S/T rs4939078 (DbSNP)
11 56,380,547 56,380,550 Del(4) -/CAGA rs72003051 (DbSNP)
11 56,380,553 56,380,556 Del(4) -/GACA rs71931749 (DbSNP)
11 56,613,341 56,613,341 NS G/T H/Q 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 130 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S282T L17Q S3F % Freq CORP
1 S L S 61.83 0.098
2 T L S 36.64 0.098
3 S L F 0.92 0.098
4 S Q S 0.61 0.098

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5M1.aApr07-unspliced main_exon 3UTR chr11 56,612,555 56,612,558 -
CDS chr11 56,612,558 56,613,502 -