Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M10 Olfactory Receptor

Gene Symbol OR5M101 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.13 (functional)
Aliases OR11-207, HsOR11.11.77, ORL3295
External Ids HGNC: 15290   GeneBank: BK004515, NM_001004741   ORDB: ORL3295   
Build #39 labels OR5M10
Chromosomal location 11:56,576,777-56,577,721 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M1 95.56% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M10 87% 315
Dog OR5M10C 86% 315
Chimp CONTIG*********** 97% 315
Chimp CONTIG*********** 95% 315
Mouse Or5m10 85% 304
Mouse Or5m10b 82% 312
Rat Or5m10 85% 304
Rat Or5m10b 83% 312
Cow OR5M10 85% 306
Cow OR5M10C 85% 306

Expression evidences

Source Accession
mRNA BC140733

Sequence information

Nucleotide sequence ATGTTGTCCCCAAACCACACCATAGTGACAGAATTCATTCTCTTAGGACTGACAGACGAC
CCAGTGCTAGAGAAGATCCTGTTTGGGGTGTTCCTGGCGATCTACCTAATCACACTGGCA
GGCAACCTGTGCATGATCCTGCTGATCAGGACCAATTCCCAACTGCAAACACCCATGTAT
TTCTTCCTTGGTCACCTCTCCTTTGTAGACATTTGCTATTCTTCCAATGTTACTCCAAAT
ATGCTGCACAATTTCCTCTCAGAACAGAAGACCATCTCCTACGCTGGATGCTTCACACAG
TGTCTTCTCTTCATCGCCCTAGTGATCACTGAGTTTTACTTCCTTGCTTCAATGGCATTG
GATCGCTATGTAGCCATTTGCAGCCCTTTACATTACAGTTCCAGGATGTCCAAGAACATT
TGCATCTCTCTGGTCACTGTGCCTTACATGTATGGCTTCCTTAATGGGCTCTCTCAGACA
CTGCTGACCTTTCACTTATCCTTCTGTGGCTCCCTTGAAATCAATCATTTCTACTGCGCT
GATCCTCCTCTTATCATGCTGGCCTGCTCTGACACCCGTGTCAAAAAGATGGCAATGTTT
GTAGTTGCAGGCTTTACTCTCTCAAGCTCTCTCTTCATCATTCTTCTGTCCTATCTTTTC
ATTTTTGCAGCGATCTTCAGGATCCGTTCTGCTGAAGGCAGGCACAAAGCCTTTTCTACG
TGTGCTTCCCACCTGACAATAGTCACTTTGTTTTATGGAACCCTCTTCTGCATGTACGTA
AGGCCTCCATCAGAGAAGTCTGTAGAGGAGTCCAAAATAATTGCAGTCTTTTATACTTTT
TTGAGCCCAATGCTGAACCCATTGATCTATAGCCTACGGAACAGAGATGTAATCCTTGCC
ATACAACAAATGATTAGGGGAAAATCCTTTTGTAAAATTGCAGTT
Conceptual translation MLSPNHTIVTEFILLGLTDDPVLEKILFGVFLAIYLITLAGNLCMILLIRTNSQLQTPMY
FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYFLASMAL
DRYVAICSPLHYSSRMSKNICISLVTVPYMYGFLNGLSQTLLTFHLSFCGSLEINHFYCA
DPPLIMLACSDTRVKKMAMFVVAGFTLSSSLFIILLSYLFIFAAIFRIRSAEGRHKAFST
CASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYTFLSPMLNPLIYSLRNRDVILA
IQQMIRGKSFCKIAV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,344,993 56,344,993 NS A/C L/V rs10792043 (DbSNP)
11 56,344,260 56,344,260 NS A/G I/T rs10896488 (DbSNP)
11 56,344,377 56,344,377 NS A/G I/T rs2852415 (DbSNP)
11 56,344,314 56,344,314 NS C/G R/T rs2852414 (DbSNP)
11 56,344,915 56,344,915 NS C/T A/T rs59116342 (DbSNP)
11 56,344,295 56,344,295 NS C/T M/I rs2852413 (DbSNP)
11 56,344,581 56,344,581 NS G/T T/N rs2852416 (DbSNP)
11 56,576,784 56,576,784 NS A/G I/T 1000GP (CEU, CHBJPT)
11 100 -100 NS A/G I/T 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 56,315,297 56,347,636 CopyNumber Variation_48849 (DGV)
11 56,323,407 56,347,636 CopyNumber Variation_48850 (DGV)
11 56,324,576 56,347,636 CopyNumber Variation_48851 (DGV)
CopyNumber 134 (Hasin)
11 56,342,253 56,345,297 Deletion #222 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I313T L162Q T110S % Freq CORP
1 I L T 81.95 0.228
2 T L T 15.13 0.228
3 I L S 2.84 0.228
4 I Q T 0.08 0.228

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5M10.aApr07-unspliced main_exon 3UTR chr11 56,576,774 56,576,777 -
CDS chr11 56,576,777 56,577,721 -