Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M11 Olfactory Receptor

Gene Symbol OR5M111 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.15 (functional)
Aliases OR11-199, HsOR11.11.76, ORL493, ORL3433
External Ids HGNC: 15291   GeneBank: AF399521, BK004656, NM_001005245   ORDB: ORL493, ORL3433   
Build #39 labels OR5M11
Chromosomal location 11:56,542,343-56,543,257 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M1 66.67% 306
OR5M10 66.99% 306
OR5M5P 66.67% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M11 90% 306
Chimp CONTIG229.45-13736 98% 305
Mouse Or5m11 86% 306
Mouse Or5m11b 85% 306
Rat Or5m11 86% 302
Cow OR5M11 84% 306

Expression evidences

Source Accession
mRNA BC136951
GNF Atlas2 gnf1h05455_at

Sequence information

Nucleotide sequence ATGTCCAACACAAATGGCAGTGCAATCACAGAATTCATTTTACTTGGGCTCACAGATTGC
CCGGAACTCCAGTCTCTGCTTTTTGTGCTGTTTCTGGTTGTTTACCTCGTCACCCTGCTA
GGCAACCTGGGCATGATAATGTTAATGAGACTGGACTCTCGCCTTCACACGCCCATGTAC
TTCTTCCTCACTAACTTAGCCTTTGTGGATTTGTGCTATACATCAAATGCAACCCCGCAG
ATGTCGACTAATATCGTATCTGAGAAGACCATTTCCTTTGCTGGTTGCTTTACACAGTGC
TACATTTTCATTGCCCTTCTACTCACTGAGTTTTACATGCTGGCAGCAATGGCCTATGAC
CGCTATGTGGCCATATATGACCCTCTGCGCTACAGTGTGAAAACGTCCAGGAGAGTTTGC
ATCTGCTTGGCCACATTTCCCTATGTCTATGGCTTCTCAGATGGACTCTTCCAGGCCATC
CTGACCTTCCGCCTGACCTTCTGTAGATCCAGTGTCATCAACCACTTCTACTGTGCTGAC
CCGCCGCTCATTAAGCTTTCTTGTTCTGATACTTATGTCAAAGAGCATGCCATGTTCATA
TCTGCTGGCTTCAACCTCTCCAGCTCCCTCACCATCGTCTTGGTGTCCTATGCCTTCATT
CTTGCTGCCATCCTCCGGATCAAATCAGCAGAGGGAAGGCACAAGGCATTCTCCACCTGT
GGTTCCCATATGATGGCTGTCACCCTGTTTTATGGGACTCTCTTTTGCATGTATATAAGA
CCACCAACAGATAAGACTGTTGAGGAATCTAAAATAATAGCTGTCTTTTACACCTTTGTG
AGTCCGGTACTTAATCCATTGATCTACAGTCTGAGGAATAAAGATGTGAAGCAGGCCTTG
AAGAATGTCCTGAGA
Conceptual translation MSNTNGSAITEFILLGLTDCPELQSLLFVLFLVVYLVTLLGNLGMIMLMRLDSRLHTPMY
FFLTNLAFVDLCYTSNATPQMSTNIVSEKTISFAGCFTQCYIFIALLLTEFYMLAAMAYD
RYVAIYDPLRYSVKTSRRVCICLATFPYVYGFSDGLFQAILTFRLTFCRSSVINHFYCAD
PPLIKLSCSDTYVKEHAMFISAGFNLSSSLTIVLVSYAFILAAILRIKSAEGRHKAFSTC
GSHMMAVTLFYGTLFCMYIRPPTDKTVEESKIIAVFYTFVSPVLNPLIYSLRNKDVKQAL
KNVLR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,310,356 56,310,356 nonsense SNP A/T Y/* rs17547284 (DbSNP)
11 56,309,889 56,309,889 NS A/G L/P rs59345582 (DbSNP)
11 56,309,896 56,309,896 NS C/G V/L rs17547207 (DbSNP)
11 56,310,222 56,310,222 NS T/C N/S rs628524 (DbSNP)
11 56,310,497 56,310,497 SYN C/T P/P rs72913727 (DbSNP)
11 56,542,880 56,542,880 nonsense SNP A/T Y/* 1000GP (CEU)
11 56,543,254 56,543,254 NS A/C S/A 1000GP (CEU)
11 56,542,420 56,542,420 NS C/G V/L 1000GP (CEU)
11 56,542,746 56,542,746 NS C/T S/N 1000GP (CEU, CHBJPT)
11 56,543,021 56,543,021 SYN C/T P/P 1000GP (CEU, CHBJPT)
11 56,542,413 56,542,413 NS G/A P/L 1000GP (CHBJPT)
11 100 -100 NS C/G V/L 1000GP (YRI, YRI, YRI)
11 100 -100 SYN C/T P/P 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 133 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P283L V281L S172N Y126* R121C A118V P79L L36V % Freq CORP
1 P V N Y R A P L 58.83 0.198
2 P V S Y R A P L 32.80 0.198
3 P L N * R A P L 4.76 1.200
4 L V N Y R A P L 2.38 0.198
5 P V S Y C A P L 0.38 0.814
6 P V N Y R V P L 0.31 0.272
7 P V N Y R A L L 0.15 0.400
8 P L N * R A P V 0.15 1.200
9 P L N Y R A P L 0.15 0.198
10 P V N Y C A P L 0.08 0.814

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5M11.aApr07-unspliced main_exon 3UTR chr11 56,542,340 56,542,343 -
CDS chr11 56,542,343 56,543,257 -