Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M13P Olfactory Receptor

Gene Symbol OR5M13P1 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-200, HsOR11.11.78P, ORL3561
External Ids HGNC: 15293   GeneBank: AF179769, AF399361, AY284101-AY284132, BK004597, NG_002281   ORDB: ORL3561   
Build #39 labels OR5M13P
Chromosomal location 11:56,597,426-56,598,362 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M10 65.38% 312
OR5M11 64.38% 306
OR5M5P 64.1% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M13 86% 309
Dog OR5M13C 85% 309
Chimp CONTIG*********** 96% 312
Mouse Or5m13 88% 312
Mouse Or5m13b 85% 307
Rat Or5m13 87% 312
Rat Or5m13b 84% 307
Cow OR5M13P 84% 312

Sequence information

Nucleotide sequence ATGTTAAAGAAAAACCATACAGCCGTGACTGAGTTTGTTCTCCTGGGACTGACAGATCGG
GCTGAGCTGCAGTCCCTTCTTTTTGTGGTATTTCTAGTCATCTACCTTATCACAGTAATC
GGCAATGTGAGCATGATCTTGTTAATCAGAAGTGACTCGACACTACACACTCCAATGTAC
TTCTTCCTCAGTCACCTCTCCTTTGTAGATCTCTGTTATACCACCAATGTTACTCCTCAG
ATGCTGGTTAACTTTTTATCCAAGAGAAAAACCATTTCCTTCATCGGCTGCTTTATCCAA
TTTCACTTTTTCATTGCACTGGTGATTACAGATTATTATATGCTCACAGTGATGGCTTAT
GACCGCTACATGGCCATCTGCAAGCCCTTGTTATATGGAAGCAAAATGACCAGGTGTGTC
TGCCTCTGTCTCGCTGCTGCTCCCTATATTTATGGCTTTGCAAATGGTCTAAGCACAGAC
CACCCTGATGCTTCGTCTGTCCTTCTGTGGACCCAATGACATCAACCACTTTTACTGTGC
GGACCCACCCCTCTTAGTCCTCGCCTGCTCAGATACTTATGTCAAAGAGACCGCCATGTT
GGTGGTGGCTGGTTCCAACCTCATTTGCTCTCTCACCGTCATCCTCATTTCCTACACTTT
CATCTTCACTGCCATTCTGCGTATCCACACTGCTGAGGGGAGGCGCAAGGCCTTCTCCAC
CTGCGGGTCTCATGTGACCGCTGTCACTGTCTTCTATGGGACACTGTTCTGCATGTACCT
GAGGCCCCCTTCTGAGACATCTATACAACAGGGGAAAATTGTAGCTGTTTTTTATATCTT
TGTGAGTCCGATGTTAAACCCATTGATCTACAGCCTGAGGAATAAAGACGTTAAAAGAAG
TATAAGGAAAGTTATTCAAAAGAAACTGTTTGCTAAG
Conceptual translation MLKKNHTAVTEFVLLGLTDRAELQSLLFVVFLVIYLITVIGNVSMILLIRSDSTLHTPMY
FFLSHLSFVDLCYTTNVTPQMLVNFLSKRKTISFIGCFIQFHFFIALVITDYYMLTVMAY
DRYMAICKPLLYGSKMTRCVCLCLAAAPYIYGFANG\AQTTLMLRLSFCGPNDINHFYC
ADPPLLVLACSDTYVKETAMLVVAGSNLICSLTVILISYTFIFTAILRIHTAEGRRKAFS
TCGSHVTAVTVFYGTLFCMYLRPPSETSIQQGKIVAVFYIFVSPMLNPLIYSLRNKDVKR
SIRKVIQKKLFAK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,365,247 56,365,247 SNP C/G rs12270384 (DbSNP)
11 56,365,407 56,365,407 SNP C/G rs11228672 (DbSNP)
11 56,365,038 56,365,038 SNP G/T rs61903260 (DbSNP)
11 56,597,562 56,597,562 SNP G/T 1000GP (CEU)
11 56,597,931 56,597,931 SNP G/C 1000GP (CEU, CHBJPT)
11 56,597,903 56,597,903 SNP C/A 1000GP (CHBJPT)
11 56,598,078 56,598,078 SNP G/A 1000GP (CHBJPT)
11 56,598,308 56,598,308 SNP C/A 1000GP (CHBJPT)
11 56,598,344 56,598,344 SNP T/G 1000GP (CHBJPT)
11 100 -100 SNP G/C 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 138 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.