Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M14P Olfactory Receptor

Gene Symbol OR5M14P1 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3129
External Ids HGNC: 15057   GeneBank: NG_004263   ORDB: ORL3129   
Build #39 labels OR5M14P, OR5M15P
Chromosomal location 4:41,723,210-41,723,563 (-)
Cluster 4@42
Synteny CLIC#0
Remarks Disrupted by Alu repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M13P 74.49% 98

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Rat Or5m11 56% 104
Orang OR5P2 46% 113
Horse OR5E1 51% 104

Sequence information

Nucleotide sequence TTCTCTTTTCTTTTCTTTTCTTTAGACCTCATTAGAAGCCAAGCAAATACAATGTCAAAG
AAACACTGGACAGCCATAGCTGAGTTTATTCCCCTGGGACCGACAGATCAAGCCGAGTTG
CAGCTTGTCCTTTTTTTCTGTCACGTTCCTGGTCATTTACCTTATTATGGTAATGGGCAA
TTTGAGCATGATTTTGATCATTAGAAGTGACTGAAAACTTCACATTCCAATGTACTTCTT
CCTCAGTCACCTCTCCTTTGCAGTTCTCTGTTATACTCTCAATGTCACTCCTCAGATATT
GGTTAATTTCCTATCCAAGAGAAAAACCATTTTCTTCATTGGTTGTGTAAGTTT
Conceptual translation FSFLFFSLDLIRSQANTMSKKHWTAIAEFIPLGPTDQAELQLVLFF\TFLVIYLIMVMG
NLSMILIIRSDXLHIPMYFFLSHLSFAVLCYTLNVTPQILVNFLSKRKTIFFIGCVS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
4 100 -100 SNP T/C 1000GP (YRI, YRI)
4 41,725,444 41,725,444 Del(1) -/A rs35078948 (DbSNP)
4 41,725,450 41,725,450 Del(1) -/A rs59423322 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
4 41,723,227 41,725,680 CopyNumber #37 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.