Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M4P Olfactory Receptor

Gene Symbol OR5M4P1 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-188, HsOR11.11.68P, ORL3506
External Ids HGNC: 14808   GeneBank: AB065503, AF399357, BK004716, NG_004152   ORDB: ORL3506   
Build #39 labels OR5M4P
Chromosomal location 11:56,448,668-56,449,592 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M3 94.81% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M3 88% 308
Chimp CONTIG229.36-29081 90% 308
Mouse Or5m3 90% 307
Mouse Or5m3b 88% 307
Rat Or5m3 90% 307
Cow OR5M3 88% 307
Cow OR5M3DP 85% 306

Sequence information

Nucleotide sequence ATGCTCAATTTCACCGATGTGACAGAGTTCATTCTTTTGGGGCTAACGAGCCGTCGGGAA
TGGCAAGTTCTCTTCTTCATCGTTTTTCTTGTGGTCTACATTATCACCGTGGTGGGCAAT
ATCGGCATGATGTTGTTAATCAAGGTCAGTCCTCAGCTTAACAGCCCCATGTACTTTTTC
CTCAGTCACTTGTCATTTGTTGATGTGTGGTTTTCTTCCAATGTCACCCCTAAAATGTTG
GAAAATCTGTTATCAGATAAAAAAAAAAACAATTTCTTATGCTGGCTGTTTAGCACAGTG
TTTCTTCTTCATTGCTCTTGTCCATGTGGAAATTTTTATTCTTGCTGCGATTGCCTTTGA
TAGATACACAGTGATTGGAAATCCTTTGCTTTATGGCAGCAAAATGTCAAGGGATGTCTG
TATTCGACTGATTACTTTCCCTTACATTTATGGTTTTCTGACGAGTCTGACAGCAACATT
ATGGACTTATGGCTTGTACTTCTGTGGAAAAATTGAGATCAACCATTTCTACTGTGCAGA
TCCACCTCTCATCAAAATGGCCTGTGCCGGGACCTTTGTAAAAGAATATACAATGCTCAT
ACTTGCCGGCATCAACTTCACATATTCCCTGACTGTAATTATCATCTCTTACTTATTCAT
CCTCATTGCCATTCTGCGAATGCGCTCAGCAGAAGGAAGGCAGAAGGCCTTTTCCACATG
TGGGTCCCATCTGACAGCTGTCATCATATTCTATGGTACTCTGATCTTCATGTATCTCAG
ACGTCCCACAGAGGAGTCTGTGGAGCAGGGGAAGATGGTGGCTGTGTTCTATACCACAGT
GATCCCCATGTTGAATCCCATGATCTACAGTCTGAGGAACAAGGATGTGAAAAAGGCCAT
GATGAAAGTGATCAGCAGATCATGT
Conceptual translation MLNFTDVTEFILLGLTSRREWQVLFFIVFLVVYIITVVGNIGMMLLIKVSPQLNSPMYFF
LSHLSFVDVWFSSNVTPKMLENL\QIKKKTISYAGCLAQCFFFIALVHVEIFILAAIAF
DRYTVIGNPLLYGSKMSRDVCIRLITFPYIYGFLTSLTATLWTYGLYFCGKIEINHFYCA
DPPLIKMACAGTFVKEYTMLILAGINFTYSLTVIIISYLFILIAILRMRSAEGRQKAFST
CGSHLTAVIIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKKA
MMKVISRSC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI)
11 56,216,402 56,216,403 Del(2) -/AA rs71652038 (DbSNP)
11 56,216,403 56,216,402 Ins(1) -/A rs66604620 (DbSNP)
11 56,216,404 56,216,405 In-Del(2) -/TT rs10584836 (DbSNP)
11 56,216,413 56,216,412 Ins(1) -/A rs57300944 (DbSNP)
11 56,216,418 56,216,418 SNP A/T rs61902031 (DbSNP)
11 56,216,429 56,216,429 SNP C/T rs61902032 (DbSNP)
11 56,216,437 56,216,437 SNP C/T rs61902033 (DbSNP)
11 56,216,651 56,216,651 Del(1) -/A rs35986277 (DbSNP)
11 56,216,821 56,216,821 SNP A/G rs11228420 (DbSNP)
11 56,449,163 56,449,163 SNP G/T 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 122 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.