Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M8 Olfactory Receptor

Gene Symbol OR5M81 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.61 (pseudogene)
Aliases OR11-194, HsOR11.11.72, ORL3322
External Ids HGNC: 14846   GeneBank: AB065744, AF399520, BK004499, NM_001005282   ORDB: ORL3322   
Build #39 labels OR5M8
Chromosomal location 11:56,490,438-56,491,370 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M6P 85.53% 311
OR5M7P 89.03% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M8 90% 304
Chimp CONTIG*********** 97% 311
Mouse Or5m8 84% 312
Rat Or5m8 84% 312
Cow OR5M45P 77% 300

Expression evidences

Source Accession
mRNA BC136980

Sequence information

Nucleotide sequence ATGAGAAGAAACTGCACGTTGGTGACTGAGTTCATTCTCCTGGGACTGACCAGTCGCCGG
GAATTACAAATTCTCCTCTTCACGCTGTTTCTGGCCATTTACATGGTCACGGTGGCAGGG
AACCTTGGCATGATTGTCCTCATCCAGGCCAACGCCTGGCTCCACATGCCCATGTACTTT
TTCCTGAGCCACTTATCCTTCGTGGATCTGTGCTTCTCTTCCAATGTGACTCCAAAGATG
CTGGAGATTTTCCTTTCAGAGAAGAAAAGCATTTCCTATCCTGCCTGTCTTGTGCAGTGT
TACCTTTTTATCGCCTTGGTCCATGTTGAGATCTACATCCTGGCTGTGATGGCCTTTGAC
CGGTACATGGCCATCTGCAACCCTCTGCTTTATGGCAGCAGAATGTCCAAGAGTGTGTGC
TCCTTCCTCATCACGGTGCCTTATGTGTATGGAGCGCTCACTGGCCTGATGGAGACCATG
TGGACCTACAACCTAGCCTTCTGTGGCCCCAATGAAATTAATCACTTCTACTGTGCGGAC
CCACCACTGATTAAGCTGGCTTGTTCTGACACCTACAACAAGGAGTTGTCAATGTTTATT
GTGGCTGGCTGGAACCTTTCTTTTTCTCTCTTCATCATATGTATTTCCTACCTTTACATT
TTCCCTGCTATTTTAAAGATTCGCTCTACAGAGGGCAGGCAAAAAGCTTTTTCTACCTGT
GGCTCCCATCTGACAGCTGTCACTATATTCTATGCAACCCTTTTCTTCATGTATCTCAGA
CCCCCCTCAAAGGAATCTGTTGAACAGGGTAAAATGGTAGCTGTATTTTATACCACAGTA
ATCCCTATGCTGAACCTTATAATTTATAGCCTTAGAAATAAAAATGTAAAAGAAGCATTA
ATCAAAGAGCTGTCAATGAAGATATACTTTTCT
Conceptual translation MRRNCTLVTEFILLGLTSRRELQILLFTLFLAIYMVTVAGNLGMIVLIQANAWLHMPMYF
FLSHLSFVDLCFSSNVTPKMLEIFLSEKKSISYPACLVQCYLFIALVHVEIYILAVMAFD
RYMAICNPLLYGSRMSKSVCSFLITVPYVYGALTGLMETMWTYNLAFCGPNEINHFYCAD
PPLIKLACSDTYNKELSMFIVAGWNLSFSLFIICISYLYIFPAILKIRSTEGRQKAFSTC
GSHLTAVTIFYATLFFMYLRPPSKESVEQGKMVAVFYTTVIPMLNLIIYSLRNKNVKEAL
IKELSMKIYFS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,258,232 56,258,232 NS G/T N/K rs61902888 (DbSNP)
11 56,490,859 56,490,859 NS T/C N/S 1000GP (CEU)
11 100 -100 NS T/A K/M 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 184 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K226M N205K N171S % Freq CORP
1 K N N 97.31 0.750
2 K K N 1.77 0.750
3 K N S 0.54 0.750
4 M N N 0.38 0.750

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5M8.aApr07-unspliced main_exon 3UTR chr11 56,490,435 56,490,438 -
CDS chr11 56,490,438 56,491,370 -