Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5P2 Olfactory Receptor

Gene Symbol OR5P21 (View this gene in GeneCards)
Family 5
Subfamily P
Pseudogene No
CORP pseudogene probability score 0.34 (functional)
Aliases OR11-93, JCG3, HsOR11.5.4P, ORL3373
External Ids HGNC: 14783   GeneBank: AB065767, AF173006, BK004322, NM_153444   ORDB: ORL3373   
Build #39 labels OR5P2
Chromosomal location 11:7,795,977-7,796,942 (-)
Cluster 11@8
Synteny CLIC#25
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5P3 63.96% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5P6 78% 312
Chimp CONTIG674.86-19152 96% 329
Mouse Or5p76 79% 314
Rat Or5p76b 78% 314
Cow OR5P76B 79% 311

Expression evidences

Source Accession
mRNA AF220494
GNF Atlas2 gnf1h05414_at

Sequence information

Nucleotide sequence ATGAATTCCCTGAAGGACGGGAATCACACCGCTCTGACGGGGTTCATCCTATTGGGCTTA
ACAGATGATCCAATCCTTCGAGTCATCCTCTTCATGATCATCCTATCTGGTAATCTCAGC
ATAATTATTCTTATCAGAATTTCTTCTCAGCTCCATCATCCTATGTATTTCTTTCTGAGC
CACTTGGCTTTTGCTGACATGGCCTATTCATCTTCTGTCACACCCAACATGCTTGTAAAC
TTCCTGGTGGAGAGAAATACAGTCTCCTACCTTGGATGTGCCATCCAGCTTGGTTCAGCG
GCTTTCTTTGCAACAGTCGAATGCGTCCTTCTGGCTGCCATGGCCTATGACCGCTTTGTG
GCAATTTGCAGTCCACTGCTTTATTCAACCAAAATGTCCACACAAGTCAGTGTCCAGCTA
CTCTTAGTAGTTTACATAGCTGGTTTTCTCATTGCTGTCTCCTATACTACTTCCTTCTAT
TTTTTACTCTTCTGTGGACCAAATCAAGTCAATCATTTTTTCTGTGATTTCGCTCCCTTA
CTTGAACTCTCCTGTTCTGATATCAGTGTCTCCACAGTTGTTCTCTCATTTTCTTCTGGA
TCCATCATTGTGGTCACTGTGTGTGTCATAGCCGTCTGCTACATCTATATCCTCATCACC
ATCCTGAAGATGCGCTCCACTGAGGGGCACCACAAGGCCTTCTCCACCTGCACTTCCCAC
CTCACTGTGGTTACCCTGTTCTATGGGACCATTACCTTCATTTATGTGATGCCCAATTTT
AGCTACTCAACTGACCAGAACAAGGTGGTGTCTGTGTTGTACACAGTGGTGATTCCCATG
TTGAACCCCCTGATCTACAGCCTCAGGAACAAGGAGATTAAGGGGGCTCTGAAGAGAGAG
CTTGTTAGAAAAATACTTTCTCATGATGCTTGTTATTTTAGTAGAACTTCAAATAATGAT
ATTACA
Conceptual translation MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLS
HLAFADMAYSSSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFV
AICSPLLYSTKMSTQVSVQLLLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPL
LELSCSDISVSTVVLSFSSGSIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSH
LTVVTLFYGTITFIYVMPNFSYSTDQNKVVSVLYTVVIPMLNPLIYSLRNKEIKGALKRE
LVRKILSHDACYFSRTSNNDIT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C N/D 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/C T/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 7,795,991 7,795,991 NS T/C N/D 1000GP (CEU, CHBJPT)
11 7,796,118 7,796,118 SYN T/C T/T 1000GP (CEU, CHBJPT)
11 7,796,305 7,796,305 NS C/G C/S 1000GP (CEU, CHBJPT)
11 7,796,309 7,796,309 NS C/T V/I 1000GP (CEU, CHBJPT)
11 7,796,412 7,796,412 SYN G/A F/F 1000GP (CEU, CHBJPT)
11 7,796,509 7,796,509 NS T/C Y/C 1000GP (CEU, CHBJPT)
11 7,796,604 7,796,604 SYN G/A A/A 1000GP (CEU, CHBJPT)
11 7,796,643 7,796,643 SYN C/T A/A 1000GP (CEU, CHBJPT)
11 7,796,766 7,796,766 SYN C/T L/L 1000GP (CEU, CHBJPT)
11 7,796,840 7,796,840 NS G/T L/I 1000GP (CEU)
11 7,796,842 7,796,842 NS A/G I/T 1000GP (CEU)
11 7,796,924 7,796,924 NS C/T G/R 1000GP (CEU)
11 7,817,538 7,817,538 NS C/T D/N rs7949771 (DbSNP)
11 7,817,665 7,817,665 SYN C/T T/T rs72484720 (DbSNP)
11 7,817,857 7,817,857 SYN A/G A/A rs1976626 (DbSNP)
11 7,817,959 7,817,959 SYN A/G F/F rs73406603 (DbSNP)
11 7,818,056 7,818,056 NS C/T C/Y rs73406604 (DbSNP)
11 7,818,151 7,818,151 SYN A/G A/A rs73406606 (DbSNP)
11 7,818,190 7,818,190 SYN C/T A/A rs73406607 (DbSNP)
11 7,818,313 7,818,313 SYN C/T L/L rs73406609 (DbSNP)
11 7,818,471 7,818,471 NS C/T G/R rs1482804 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
Deletion 249 (Hasin)
11 7,785,603 7,838,917 CopyNumber Variation_35016 (DGV)
11 7,802,490 7,828,642 CopyNumber Variation_85638 (DGV)
11 7,806,326 7,852,026 CopyNumber Variation_35017 (DGV)
11 7,811,220 7,836,387 CopyNumber Variation_22901 (DGV)
11 7,812,858 7,832,650 CopyNumber Variation_65859 (DGV)
11 7,813,040 7,841,583 CopyNumber Variation_38039 (DGV)
11 7,813,081 7,830,280 CopyNumber Variation_75537 (DGV), Variation_85640 (DGV)
11 7,813,400 7,830,036 CopyNumber Variation_37481 (DGV)
11 7,813,900 7,820,452 CopyNumber Variation_85641 (DGV)
11 7,815,524 7,818,589 Deletion #20 (Waszak)
11 7,816,357 7,827,823 CopyNumber Variation_85639 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N318D C213S V212I Y145C R118H G7R % Freq CORP
1 N C V Y R G 64.44 0.283
2 D S I C R G 26.04 0.118
3 N C V Y R R 6.84 0.283
4 N C V Y H G 0.84 0.875
5 D C V C R G 0.61 0.283
6 D C V Y R G 0.38 0.283
7 N C V Y H R 0.38 0.875
8 N S I C R G 0.15 0.118
9 N C I Y R G 0.15 0.283
10 D S I C R R 0.08 0.118
11 N S I Y R G 0.08 0.118

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5P2.aApr07-unspliced main_exon 3UTR chr11 7,795,905 7,795,977 -
CDS chr11 7,795,977 7,796,942 -
5UTR chr11 7,796,942 7,796,973 -