Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5P3 Olfactory Receptor

Gene Symbol OR5P31 (View this gene in GeneCards)
Family 5
Subfamily P
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases OR11-94, JCG1, HsOR11.5.5, ORL3284
External Ids HGNC: 14784   GeneBank: AB065770, AF158377, AF399366, BK004321, NM_153445   ORDB: ORL3284   
Build #39 labels OR5P3
Chromosomal location 11:7,825,040-7,825,972 (-)
Cluster 11@8
Synteny CLIC#25
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5P1P 70.74% 311
OR5P2 63.96% 308
OR5P4P 66.01% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5P5 72% 303
Chimp CONTIG*********** 99% 311
Mouse Or5p80 80% 303
Rat Or5p80 80% 303
Cow OR5P3 84% 303

Expression evidences

Source Accession
mRNA AB463971
GNF Atlas2 gnf1h08028_at

Sequence information

Nucleotide sequence ATGGGGACTGGAAATGACACCACTGTGGTAGAGTTTACTCTTTTGGGGTTATCTGAGGAT
ACTACAGTTTGTGCTATTTTATTTCTTGTGTTTCTAGGAATTTATGTTGTCACCTTAATG
GGTAATATCAGCATAATTGTATTGATCAGAAGAAGTCATCATCTTCATACACCCATGTAC
ATTTTCCTCTGCCATTTGGCCTTTGTAGACATTGGGTACTCCTCATCAGTCACACCTGTC
ATGCTCATGAGCTTCCTAAGGAAAGAAACCTCTCTCCCTGTTGCTGGTTGTGTGGCCCAG
CTCTGTTCTGTAGTGACGTTTGGTACGGCCGAGTGCTTCCTGCTGGCTGCCATGGCCTAT
GATCGCTATGTGGCCATCTGCTCACCCCTGCTCTACTCTACCTGCATGTCCCCTGGAGTC
TGCATCATCTTAGTGGGCATGTCCTACCTGGGTGGATGTGTGAATGCTTGGACATTCATT
GGCTGCTTATTAAGACTGTCCTTCTGTGGGCCAAATAAAGTCAATCACTTTTTCTGTGAC
TATTCACCACTTTTGAAGCTTGCTTGTTCCCATGATTTTACTTTTGAAATAATTCCAGCT
ATCTCTTCTGGATCTATCATTGTGGCCACTGTGTGTGTCATAGCCATATCCTACATCTAT
ATCCTCATCACCATCCTGAAGATGCACTCCACCAAGGGCCGCCACAAGGCCTTCTCCACC
TGCACCTCCCACCTCACTGCAGTCACTCTGTTCTATGGGACCATTACCTTCATTTATGTG
ATGCCCAAGTCCAGCTACTCAACTGACCAGAACAAGGTGGTGTCTGTGTTCTACACCGTG
GTGATTCCCATGTTGAACCCCCTGATCTACAGCCTCAGGAACAAGGAGATTAAGGGGGCT
CTGAAGAGAGAGCTTAGAATAAAAATATTTTCT
Conceptual translation MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMY
IFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAY
DRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCD
YSPLLKLACSHDFTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFST
CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGA
LKRELRIKIFS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C I/M 1000GP (YRI, YRI, YRI)
11 100 -100 SYN A/G L/L 1000GP (YRI, YRI, YRI, YRI, YRI)
11 7,825,325 7,825,325 SYN T/A I/I 1000GP (CEU)
11 7,825,333 7,825,333 NS T/A I/L 1000GP (CHBJPT)
11 7,825,361 7,825,361 SYN T/A G/G 1000GP (CHBJPT)
11 7,825,609 7,825,609 NS G/A R/C 1000GP (CHBJPT)
11 7,825,661 7,825,661 SYN T/C V/V 1000GP (CEU, CHBJPT)
11 7,825,919 7,825,919 SYN A/G S/S 1000GP (CEU, CHBJPT)
11 7,825,925 7,825,925 SYN C/T G/G 1000GP (CEU, CHBJPT)
11 7,846,599 7,846,599 NS T/C I/M rs61734816 (DbSNP)
11 7,846,689 7,846,689 NS G/T F/L rs450205 (DbSNP)
11 7,846,755 7,846,755 SYN A/G I/I rs377363 (DbSNP)
11 7,846,767 7,846,767 NS G/T F/L rs364427 (DbSNP)
11 7,846,772 7,846,772 NS C/G V/L rs364435 (DbSNP)
11 7,846,783 7,846,783 NS C/G S/T rs364444 (DbSNP)
11 7,846,941 7,846,941 NS A/C F/L rs73406693 (DbSNP)
11 7,846,967 7,846,967 SYN A/G L/L rs61525942 (DbSNP)
11 7,847,047 7,847,047 NS G/T T/K rs16932503 (DbSNP)
11 7,847,049 7,847,049 NS C/G W/C rs449911 (DbSNP)
11 7,847,208 7,847,208 SYN C/T V/V rs1482791 (DbSNP)
11 7,847,348 7,847,348 NS C/G A/P rs60467657 (DbSNP)
11 7,847,458 7,847,458 NS G/A T/I rs61742097 (DbSNP)
11 7,847,466 7,847,466 SYN A/G S/S rs1482792 (DbSNP)
11 7,847,472 7,847,472 SYN C/T G/G rs1482793 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 7,806,326 7,852,026 CopyNumber Variation_35017 (DGV)
11 7,844,587 7,847,619 Deletion #285 (Waszak)
11 7,846,597 7,847,543 InDel Variation_85643 (DGV)
11 7,846,698 7,847,592 InDel Variation_65860 (DGV)
11 7,846,855 7,847,629 InDel Variation_85642 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I307M T158K L131F R122C P93S P58A T21I % Freq CORP
1 I T L R P P T 96.62 0.124
2 M T L R P P T 1.54 0.124
3 I K L R P P I 0.84 0.124
4 I T F R P P T 0.54 0.124
5 I T L R P A T 0.23 0.232
6 I T L R P P I 0.08 0.124
7 I T L C P P T 0.08 0.716
8 I T L R S P T 0.08 0.124

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5P3.aApr07-unspliced main_exon 3UTR chr11 7,825,037 7,825,040 -
CDS chr11 7,825,040 7,825,972 -