Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5P4P Olfactory Receptor

Gene Symbol OR5P4P1 (View this gene in GeneCards)
Family 5
Subfamily P
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.5.2P, ORL3645
External Ids HGNC: 15295   GeneBank: AF399367, NG_004189   ORDB: ORL3645   
Build #39 labels OR5P4P
Chromosomal location 11:7,745,990-7,746,909 (+)
Cluster 11@8
Synteny CLIC#25
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5P1P 64.4% 309
OR5P3 66.01% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5P4 88% 312
Chimp CONTIG*********** 96% 312
Mouse Or5p4 83% 311
Rat Or5p4 83% 311
Cow OR5P4 85% 311

Expression evidences

Source Accession
ESTs BF328527

Sequence information

Nucleotide sequence ATGGAGACTGAAAACAATACAACAGTGACAGAGTTCATTATTTTGGGATTAACAGACAAT
CCTATGCTATGTGCCATTTTCTTCGTGTTTTTTCTAGCAGTTTATATAGTTACTATACCG
GGAAATATTAGCATAATCCTCTTAATCCAAAGCAGCCCACAGCTTCACACGCTAATGTAC
CTTTTTCTCAGCCATTTGGCTTCTGTGGACATTGGGTATTCCATATCAGTTACGCCAATC
ATTCTCATCAATTTCTTAAGAGAGAAAACGACTATTCCTGTCACAGGCTGTATAGCACAG
CTTGGCTCTGATGTCATGTTTGGAACCACAGAGTGCTTCCTGCTGGTCACTATGTGGCTA
TCTGCTCTCCCCTGCTTTACTCCATCCAAATGCCCCCAGTCGTCTGCTTCCTCCTACTGG
GAGCCTCCTACCTGGGTGGATGCCTGAACGCTTCGTCTTTTACAGGCTGTTTGATGAACC
TGTCCTTCTGCGGTCCAAATAAAATCAACCACTTTTTCTGTGACCTCTTCCCACTCTTGA
AGCTTTCTTGTGGCCATGTTTACATTGCTGAAATATCCCCTGCCATCTCCTCTGCATCTG
TCCTTATCAGCACGCTGTTTACCATAATCGTGTCCTACATCTACATCCTTCACTCCATCC
TGAAGGTGTGCTCTACTGAGGGAAGGAAGAAGGCTTTCTCCACCTGCGCTTCCCACCTCA
CTGCAGTCACTTTGTTCTATGGGACCATTTTGTTTGTTTATGTGATGCCCAAGTCAAGCT
ATTCAGCGGATCAGGTCAAGGTGGCATTTGTGATCTACACGGTGGTGATTCCCATGCTGA
ACCCCCTCATCTACAGTCTCAGGAATAAGGAGGTGAAAGAGGCCATGAGAAAATTGATGG
CAAGAACACATTGGTTTTCC
Conceptual translation METENNTTVTEFIILGLTDNPMLCAIFFVFFLAVYIVTIPGNISIILLIQSSPQLHTLMY
LFLSHLASVDIGYSISVTPIILINFLREKTTIPVTGCIAQLGSDVMFGTTECFLL/HYV
AICSPLLYSIQMPPVVCFLLLGASYLGGCLNASSFTGCLMNLSFCGPNKINHFFCDLFPL
LKLSCGHVYIAEISPAISSASVLISTLFTIIVSYIYILHSILKVCSTEGRKKAFSTCASH
LTAVTLFYGTILFVYVMPKSSYSADQVKVAFVIYTVVIPMLNPLIYSLRNKEVKEAMRKL
MARTHWFS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI)
11 7,745,992 7,745,992 SNP G/A 1000GP (CEU, CHBJPT)
11 7,746,108 7,746,108 SNP C/T 1000GP (CEU, CHBJPT)
11 7,746,162 7,746,162 SNP T/C 1000GP (CEU, CHBJPT)
11 7,746,213 7,746,213 SNP T/C 1000GP (CEU, CHBJPT)
11 7,746,320 7,746,320 SNP G/C 1000GP (CEU)
11 7,746,777 7,746,777 SNP G/A 1000GP (CEU)
11 7,767,539 7,767,539 SNP A/G rs12226332 (DbSNP)
11 7,767,655 7,767,655 SNP C/T rs7951346 (DbSNP)
11 7,767,709 7,767,709 SNP C/T rs7940676 (DbSNP)
11 7,767,760 7,767,760 SNP C/T rs7940802 (DbSNP)
11 7,768,001 7,768,001 SNP G/T rs57412179 (DbSNP)
11 7,768,128 7,768,128 SNP C/G rs810424 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.