Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5R1 Olfactory Receptor

Gene Symbol OR5R11 (View this gene in GeneCards)
Family 5
Subfamily R
Pseudogene No
CORP pseudogene probability score
Aliases OR11-185, HsOR11.11.67
External Ids HGNC: 14841   GeneBank: AB065504, BK004514, NM_001004744   
Build #39 labels OR5R1P
Chromosomal location 11:56,417,261-56,418,232 (-)
Cluster 11@56
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs7111634 and rs6591324)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8U1 68.2% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5R1 91% 322
Chimp CONTIG229.26-11956 67% 305
Chimp CONTIG*********** 95% 221
Mouse Or5r1 91% 279
Rat Or5r1 90% 319
Cow OR5R1 88% 322

Expression evidences

Source Accession
GNF Atlas2 gnf1h05459_at

Sequence information

Nucleotide sequence ATGGCTGAAGTTAATATCATTTATGTCACTGTATTCATTCTGAAAGGAATTACCAACCGG
CCAGAGCTTCAGGCCCCGTGCTTTGGGGTGTTTTTAGTTATCTATCTGGTCACAGTGCTG
GGCAATCTTGGGTTGATTACTTTAATCAAGATTGATACTCGACTCCACACACCTATGTAC
TATTTCCTCAGCCACCTGGCCTTTGTTGACCTTTGTTACTCCTCTGCTATTACACCGAAG
ATGATGGTGAATTTTGTTGTGGAACGCAACACCATTCCTTTCCATGCTTGTGCAACCCAA
CTGGGTTGTTTTCTCACCTTCATGATCACTGAGTGTTTCCTTCTAGCCTCCATGGCCTAC
GATTGCTATGTCGCCATCTGTAGTCCCCTGCATTATTCAACACTGATGTCAAGAAGAGTC
TGCATTCAACTGGTGGCAGTTCCATATATATACAGCTTCCTGGTTGCCCTCTTCCACACC
GTTATCACTTTCCGTCTGACTTACTGTGGCCCAAACTTAATTAACCATTTCTATTGTGAT
GACCTCCCCTTCTTAGCTCTGTCCTGCTCAGACACACACATGAAGGAAATTCTGATATTT
GCCTTTGCTGGCTTTGATATGATCTCTTCCTCTTCCATTGTCCTCACCTCCTACATCTTT
ATTATTGCCGCTATCCTAAGGATCCGCTCTACTCAGGGGCAACACAAAGCCATTTCCACC
TGTGGCTCCCATATGGTGACTGTCACTATTTTCTATGGCACACTGATCTTTATGTACCTA
CAGCCCAAATCAAATCACTCCTTGGACACAGACAAGATGGCTTCTGTATTTTACACAGTG
GTGATCCCCATGTTAAACCCCCTAATCTATAGTCTAAGGAACAAAGAAGTGAAAGATGCC
TCAAAGAAAGCCTTGGATAAAGGTTGTGAAAACTTACAGATATTAACATTTTTAAAAATA
AGAAAACTTTAT
Conceptual translation MAEVNIIYVTVFILKGITNRPELQAPCFGVFLVIYLVTVLGNLGLITLIKIDTRLHTPMY
YFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAY
DCYVAICSPLHYSTLMSRRVCIQLVAVPYIYSFLVALFHTVITFRLTYCGPNLINHFYCD
DLPFLALSCSDTHMKEILIFAFAGFDMISSSSIVLTSYIFIIAAILRIRSTQGQHKAIST
CGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDA
SKKALDKGCENLQILTFLKIRKLY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A A/V 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/C L/L 1000GP (YRI)
11 56,184,888 56,184,888 NS G/A A/V rs998544 (DbSNP)
11 56,185,153 56,185,153 NS C/T A/T rs61901985 (DbSNP)
11 56,185,159 56,185,159 NS A/G F/L rs7930678 (DbSNP)
11 56,185,224 56,185,224 NS A/G I/T rs12785840 (DbSNP)
11 56,185,315 56,185,315 NS A/G Y/H rs17150578 (DbSNP)
11 56,185,327 56,185,327 NS C/T G/S rs7933772 (DbSNP)
11 56,185,345 56,185,345 NS A/G C/R rs6591324 (DbSNP)
11 56,185,347 56,185,347 NS C/T G/D rs7111634 (DbSNP)
11 56,185,401 56,185,401 NS C/T C/Y rs7123108 (DbSNP)
11 56,185,689 56,185,689 NS A/G I/T rs7931261 (DbSNP)
11 56,417,412 56,417,412 NS G/A A/V 1000GP (CEU, CHBJPT)
11 56,417,548 56,417,548 NS G/A R/C 1000GP (CEU)
11 56,417,677 56,417,677 NS C/T A/T 1000GP (CEU)
11 56,417,683 56,417,683 NS A/G F/L 1000GP (CEU, CHBJPT)
11 56,417,748 56,417,748 NS A/G I/T 1000GP (CEU, CHBJPT)
11 56,417,851 56,417,851 NS T/C S/G 1000GP (CEU, CHBJPT)
11 56,417,869 56,417,869 NS A/G C/R 1000GP (CEU, CHBJPT)
11 56,417,871 56,417,871 NS T/C D/G 1000GP (CEU)
11 56,417,925 56,417,925 NS C/T C/Y 1000GP (CEU)
11 56,418,213 56,418,213 NS A/G I/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 208 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A274V R229H N172K I162T Y132H S128G Y123C C122R D121G C103Y P21L I7T % Freq CORP
1 V R N I Y S Y R D C P I 40.02 0.130
2 A R N I Y G Y R D C P T 27.19 0.130
3 A R N T Y S Y C D C P I 13.98 0.727
4 A R N I Y S Y C D C P I 9.98 0.727
5 A R N I Y S Y R G Y P I 4.61 1.000
6 A R N I Y S Y R D C P I 1.15 0.130
7 A R N I Y S Y R D C P T 0.92 0.130
8 A R N I Y G Y R D C L T 0.69 0.130
9 A R N I H G Y R D C P T 0.54 1.000
10 V R N I Y S Y C D C P I 0.15 0.727
11 A R N I Y S Y R D Y P I 0.15 0.130
12 A R K I Y S C R D C P I 0.15 0.089
13 V H N I Y S Y R D C P I 0.15 0.130
14 A R N I Y G Y R D Y P T 0.08 0.130
15 V R N I Y G Y R D C P T 0.08 0.130
16 A R N I H S Y R D C P T 0.08 1.000
17 A R N I Y G Y R G Y P T 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5R1.aApr07-unspliced main_exon 3UTR chr11 56,417,258 56,417,261 -
CDS chr11 56,417,261 56,418,232 -