Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5T3 Olfactory Receptor

Gene Symbol OR5T31 (View this gene in GeneCards)
Family 5
Subfamily T
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-178, HsOR11.11.55, ORL3338
External Ids HGNC: 15297   GeneBank: AB065837, BK004335, NM_001004747   ORDB: ORL3338   
Build #39 labels OR5T3
Chromosomal location 11:56,252,200-56,253,219 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5T1 83.23% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5T1 84% 316
Dog OR5T1B 83% 315
Chimp CONTIG*********** 86% 295
Chimp CONTIG79864.1-263 96% 262
Chimp CONTIG229.7-353 94% 261
Mouse Or5t5 79% 318
Rat Or5t5b 77% 318
Cow OR5T1 79% 316

Expression evidences

Source Accession
GNF Atlas2 gnf1h10905_at

Sequence information

Nucleotide sequence ATGGACTCCACTTTCACAGGCTATAACCTTTATAACCTGCAAGTAAAAACTGAAATGGAC
AAGTTGTCATCAGGTTTGGATATATACAGGAATCCACTGAAGAACAAGACTGAAGTCACC
ATGTTTATATTGACAGGCTTCACAGATGATTTTGAGCTGCAAGTCTTCCTATTTTTACTA
TTTTTTGCAATCTATCTCTTTACCTTGATAGGCAATTTAGGGCTGGTTGTGTTGGTCATT
GAGGATTCCTGGCTCCACAACCCCATGTATTATTTTCTTAGTGTTTTATCATTCTTGGAT
GCTTGCTATTCTACAGTTGTCACTCCAAAAATGTTGGTCAATTTCCTGGCAAAAAATAAA
TCCATTTCATTTATCGGATGTGCAACACAGATGCTTCTTTTTGTTACTTTTGGAACTACA
GAATGTTTTCTCTTGGCTGCAATGGCTTATGATCACTATGTAGCCATCTACAACCCTCTC
CTGTATTCAGTGAGCATGTCACCCAGAGTCTATGTGCCACTCATCACTGCTTCCTACGTT
GCTGGCATTTTACATGCTACTATACATATAGTGGCTACATTTAGCCTGTCCTTCTGTGGA
TCCAATGAAATTAGGCATGTCTTTTGTGATATGCCTCCTCTCCTTGCTATTTCTTGTTCT
GACACTCACACAAACCAGCTTCTACTCTTCTACTTTGTGGGTTCTATTGAGATAGTCACT
ATCCTGATTGTCCTCATTTCCTGTGATTTCATTCTGTTGTCCATTCTGAAGATGCATTCT
GCTAAGGGAAGGCAAAAGGCCTTCTCTACATGTGGCTCTCACCTAACTGGAGTGACAATT
TATCATGGAACAATTCTCGTCAGTTATATGAGACCAAGTTCCAGCTATGCTTCAGACCAT
GACATCATAGTGTCAATATTTTACACAATTGTGATTCCCAAGTTGAATCCCATCATCTAT
AGTTTGAGGAACAAAGAAGTAAAAAAGGCAGTGAAGAAAATGTTGAAATTGGTTTACAAA
Conceptual translation MDSTFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMFILTGFTDDFELQVFLFLL
FFAIYLFTLIGNLGLVVLVIEDSWLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLAKNK
SISFIGCATQMLLFVTFGTTECFLLAAMAYDHYVAIYNPLLYSVSMSPRVYVPLITASYV
AGILHATIHIVATFSLSFCGSNEIRHVFCDMPPLLAISCSDTHTNQLLLFYFVGSIEIVT
ILIVLISCDFILLSILKMHSAKGRQKAFSTCGSHLTGVTIYHGTILVSYMRPSSSYASDH
DIIVSIFYTIVIPKLNPIIYSLRNKEVKKAVKKMLKLVYK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/C I/L 1000GP (YRI)
11 100 -100 SYN C/T L/L 1000GP (YRI)
11 56,019,925 56,019,925 NS G/T G/W rs17150243 (DbSNP)
11 56,020,244 56,020,244 NS C/T T/I rs61746551 (DbSNP)
11 56,020,438 56,020,438 NS A/C I/L rs61747480 (DbSNP)
11 56,020,533 56,020,533 SYN C/T L/L rs61750919 (DbSNP)
11 56,020,615 56,020,615 NS A/G K/E rs73474358 (DbSNP)
11 56,020,695 56,020,695 NS A/C K/N rs61753411 (DbSNP)
11 56,252,294 56,252,294 NS C/T P/L 1000GP (CEU)
11 56,252,299 56,252,299 NS A/C K/Q 1000GP (CEU)
11 56,252,449 56,252,449 NS T/G W/G 1000GP (CHBJPT)
11 56,252,573 56,252,573 NS T/C I/T 1000GP (CHBJPT)
11 56,252,635 56,252,635 NS G/T A/S 1000GP (CEU)
11 56,252,768 56,252,768 NS T/C I/T 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 47 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K34Q W84G I125T A146S I190T I255L K340N % Freq CORP
1 K W I A I I K 86.25 1.000
2 K W I A T I K 6.91 1.000
3 K G I A I I K 3.53 1.000
4 K W T A I I K 2.61 1.000
5 K W I A I L N 0.46 1.000
6 K W I S I I K 0.08 1.000
7 K G I A T I K 0.08 1.000
8 Q W I A I I K 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5T3.aApr07-unspliced main_exon CDS chr11 56,252,200 56,253,219 +
3UTR chr11 56,253,219 56,253,222 +