Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5V1 Olfactory Receptor

Gene Symbol OR5V11 (View this gene in GeneCards)
Family 5
Subfamily V
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR6-26, hs6M1-21, bA150A6.2, HsOR6.3.17, ORL1029
External Ids HGNC: 13972   GeneBank: BC069149, BK004440, HSA459859, NM_030876   ORDB: ORL1029   
Build #39 labels OR5V1
Chromosomal location 6:29,355,233-29,356,195 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13D1 49.84% 307
OR5G3P 49.34% 302
OR9G4 51.29% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13L2 55% 310
Chimp CONTIG*********** 98% 321
Mouse Or5v1 83% 316
Mouse Or5v1b 83% 316
Rat Or5v1b 82% 316
Cow OR5V1 86% 316

Expression evidences

Source Accession
mRNA AB463953
GNF Atlas2 gnf1h00457_at

Sequence information

Nucleotide sequence ATGGAAAGAAAGAATCAAACAGCTATAACTGAATTCATCATCTTGGGATTCTCCAACCTA
AATGAATTGCAGTTTTTACTATTCACCATCTTCTTTCTGACTTATTTCTGTACTTTGGGA
GGAAATATATTAATTATCTTGACGACTGTGACTGATCCACACCTGCATACACCTATGTAT
TATTTTCTAGGGAACTTGGCCTTTATTGACATCTGCTACACCACCAGCAATGTCCCCCAG
ATGATGGTGCACCTCCTCTCAAAGAAAAAAAGCATTTCTTATGTGGGGTGTGTGGTTCAA
CTTTTTGCATTTGTTTTCTTTGTAGGATCAGAGTGTCTCCTACTGGCAGCAATGGCATAT
GATCGTTACATTGCAATCTGCAATCCTTTAAGGTATTCAGTTATTCTGAGCAAGGTTCTA
TGCAATCAATTAGCAGCCTCATGCTGGGCTGCTGGTTTCCTTAACTCAGTGGTGCATACA
GTGTTGACATTCTGCCTGCCCTTCTGTGGCAACAATCAGATTAATTACTTCTTCTGTGAC
ATCCCCCCTTTGCTGATCTTGTCTTGTGGAAACACTTCTGTCAATGAGTTGGCACTGCTA
TCCACTGGGGTCTTCATTGGTTGGACTCCTTTCCTTTGTATCGTACTTTCCTACATTTGC
ATAATCTCCACCATCTTGAGGATCCAGTCCTCAGAGGGAAGACGAAAAGCCTTTTCTACA
TGTGCCTCCCACCTGGCCATTGTCTTTCTCTTTTATGGCAGCGCCATCTTTACATATGTA
CGGCCCATCTCAACTTACTCATTAAAGAAAGATAGGTTGGTTTCAGTGTTGTACAGTGTT
GTTACCCCCATGCTAAACCCTATAATTTACACATTGAGGAATAAGGACATCAAAGAAGCT
GTCAAAACTATAGGGAGCAAGTGGCAGCCACCAATTTCCTCTTTGGATAGTAAACTCACT
TAT
Conceptual translation MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMY
YFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAY
DRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCD
IPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFST
CASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEA
VKTIGSKWQPPISSLDSKLTY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS C/T G/R 1000GP (YRI, YRI)
6 100 -100 SYN G/A F/F 1000GP (YRI, YRI)
6 29,323,076 29,323,076 SYN C/T E/E rs9257769 (DbSNP)
6 29,323,245 29,323,245 NS C/G C/S rs41271546 (DbSNP)
6 29,323,259 29,323,259 SYN A/G F/F rs3117438 (DbSNP)
6 29,323,276 29,323,276 NS T/C R/G rs61742983 (DbSNP)
6 29,323,655 29,323,655 SYN A/G F/F rs7761746 (DbSNP)
6 29,323,664 29,323,664 SYN C/T A/A rs28359952 (DbSNP)
6 29,323,838 29,323,838 NS A/C I/M rs9257770 (DbSNP)
6 29,323,905 29,323,905 NS A/C L/W rs6930033 (DbSNP)
6 29,355,299 29,355,299 SYN T/C E/E 1000GP (CEU, CHBJPT)
6 29,355,468 29,355,468 NS G/C S/C 1000GP (CEU)
6 29,355,482 29,355,482 SYN G/A F/F 1000GP (CEU, CHBJPT)
6 29,355,878 29,355,878 SYN G/A F/F 1000GP (CEU, CHBJPT)
6 29,355,887 29,355,887 SYN T/C A/A 1000GP (CHBJPT)
6 29,356,061 29,356,061 NS A/C I/M 1000GP (CEU, CHBJPT)
6 29,356,128 29,356,128 NS A/C L/W 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S243C G233R I46V I45M L23W % Freq CORP
1 S G I I L 67.20 0.217
2 S G I I W 22.96 0.217
3 S R I I L 6.68 0.183
4 S G I M L 2.61 0.217
5 C G I I L 0.31 0.044
6 S G V I L 0.23 0.217

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11A1andOR5V1.bApr07 main_exon 3UTR chr6 29,355,229 29,355,233 -
CDS chr6 29,355,233 29,356,195 -
5UTR chr6 29,356,195 29,356,277 -