Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6A2 Olfactory Receptor

Gene Symbol OR6A21 (View this gene in GeneCards)
Family 6
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.21 (functional)
Aliases OR11-55, OR11-72, OR11-80, OR11-84, OR11-77, HsOR11.4.3
External Ids HGNC: 15301   GeneBank: AB065822, AF399472, BK004533, BK004672, BK004735, NM_003696   
Build #39 labels OR6A2, OR6A1
Chromosomal location 11:6,794,728-6,795,708 (-)
Cluster 11@7
Synteny CLIC#24
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6B1 57.84% 306
OR6P1 58.72% 298
OR6Y1 57.56% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6A2 91% 326
Chimp CONTIG784.16-5356 99% 327
Mouse Or6a2 90% 326
Rat Or6a2b 90% 326
Rat Or6a2 90% 326
Cow OR6A2 89% 319

Expression evidences

Source Accession
mRNA BC101491
GNF Atlas2 221465_at

Sequence information

Nucleotide sequence ATGGAGTGGCGGAACCATAGTGGGAGAGTGAGTGAGTTTGTGTTGCTGGGCTTCCCTGCT
CCTGCGCCACTACAGGTACTATTGTTTGCCCTTTTGCTGCTGGCCTATGTGTTGGTGCTG
ACTGAGAACACACTCATCATTATGGCAATTAGGAACCATTCTACCCTCCACAAACCCATG
TACTTTTTTCTAGCTAATATGTCCTTTCTGGAGATCTGGTATGTCACTGTCACTATTCCC
AAGATGCTTGCTGGCTTTGTTGGATCCAAACAGGATCATGGACAGCTAATCTCCTTTGAG
GGATGCATGACACAGCTCTACTTTTTCCTTGGCTTGGGCTGCACTGAGTGTGTCCTTCTC
GCTGTTATGGCCTATGATCGCTATATGGCCATCTGCTATCCTCTCCACTACCCAGTCATT
GTCAGTGGCCGGCTGTGTGTGCAGATGGCTGCTGGCTCTTGGGCTGGAGGTTTTGGCATC
TCCATGGTCAAAGTTTTTCTTATTTCTGGCCTCTCTTACTGTGGCCCCAACATCATCAAC
CACTTTTTCTGTGATGTCTCTCCATTGCTCAACCTCTCATGCACTGATATGTCCACAGCA
GAGCTTACAGATTTCATCCTGGCCATTTTTATTCTTCTAGGGCCACTCTCTGTCACTGGG
GCCTCCTATGTGGCCATTACTGGTGCTGTGATGCACATTCCTTCGGCTGCTGGACGCTAT
AAGGCCTTTTCCACCTGTGCCTCTCATCTCACTGTTGTGATAATCTTCTATGCAGCCAGT
ATCTTCATCTATGCTCGGCCAAAGGCACTCTCAGCTTTTGACACCAACAAGTTGGTCTCT
GTACTGTATGCTGTCATTGTACCATTGCTCAATCCCATCATTTACTGCCTGCGCAATCAA
GAGGTCAAGAGAGCCCTATGCTGTACTCTGCACCTGTACCAGCACCAGGATCCTGACCCC
AAGAAAGCTAGCAGAAATGTA
Conceptual translation MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAIRNHSTLHKPM
YFFLANMSFLEIWYVTVTIPKMLAGFVGSKQDHGQLISFEGCMTQLYFFLGLGCTECVLL
AVMAYDRYMAICYPLHYPVIVSGRLCVQMAAGSWAGGFGISMVKVFLISGLSYCGPNIIN
HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRY
KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ
EVKRALCCTLHLYQHQDPDPKKASRNV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,816,293 6,816,294 Del(2) -/AG rs71946386 (DbSNP)
11 6,816,875 6,816,875 NS A/G V/A rs7122644 (DbSNP)
11 6,816,792 6,816,792 NS C/T V/I rs61741824 (DbSNP)
11 6,816,317 6,816,317 NS G/A A/V rs61741823 (DbSNP)
11 6,816,242 6,816,242 NS G/A T/I rs2741744 (DbSNP)
11 6,816,240 6,816,240 NS G/A P/S rs2741745 (DbSNP)
11 6,816,579 6,816,579 NS T/C T/A rs61741822 (DbSNP)
11 6,816,778 6,816,778 SYN A/G S/S rs866347 (DbSNP)
11 6,795,547 6,795,547 SYN A/G S/S 1000GP (CEU, CHBJPT)
11 6,795,644 6,795,644 NS G/A A/V 1000GP (CEU, CHBJPT)
11 6,795,561 6,795,561 NS T/C I/V 1000GP (CEU)
11 100 -100 NS C/T A/T 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G S/S 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 6,813,959 6,817,039 CopyNumber #137 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A259T V253A A208V H93Y I50V A22V R4Q % Freq CORP
1 A V A H I A R 66.59 0.620
2 A V A H I V R 29.19 0.620
3 A V A H V A R 1.69 0.620
4 T V A H I A R 0.84 0.620
5 A V V H I A R 0.61 0.620
6 A V A Y I A R 0.46 0.620
7 A V A H I A Q 0.31 0.620
8 A A A H I A R 0.23 0.750
9 T V A H I V R 0.08 0.620

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6A2.aApr07-unspliced main_exon 3UTR chr11 6,794,525 6,794,728 -
CDS chr11 6,794,728 6,795,708 -
5UTR chr11 6,795,708 6,795,908 -