Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6B1 Olfactory Receptor

Gene Symbol OR6B11 (View this gene in GeneCards)
Family 6
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR7-3, OR7-9, WUGSC:H_DJ0669B10.3, HsOR7.6.9, ORL3368
External Ids HGNC: 8354   GeneBank: AF399605, BK004216, NM_001005281   ORDB: ORL3368   
Build #39 labels OR6B1
Chromosomal location 7:144,003,997-144,004,929 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6A2 57.84% 306
OR6P1 57.63% 295
OR6Y1 54.52% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6B9 62% 303
Mouse Or6b1 93% 311
Rat Or6b1 92% 311
Cow OR6B6 62% 300
Orang OR6B3P 58% 303
Horse OR6B9 61% 303
Chimp OR6B1P 99% 311

Expression evidences

Source Accession
ESTs EG357682
mRNA BC137047

Sequence information

Nucleotide sequence ATGGAGTTGGAGAACCAGACACGAGTCACCAAGTTCATTCTGGTGGGATTCCCTGGGAGC
TTGAGTATGCGGGCAGCCATGTTTCTGATATTCCTTGTGGCCTATATTCTGACAGTGGCT
GAAAACGTGATCATCATCCTATTGGTGCTGCAAAATCGGCCACTGCACAAGCCTATGTAC
TTCTTCCTGGCCAACCTGTCCTTCTTGGAGACCTGGTACATCTCTGTGACTGTGCCCAAG
TTACTGTTTAGTTTTTGGTCTGTGAACAACAGCATCTCTTTCACACTCTGTATGATACAA
CTGTACTTCTTCATTGCTCTCATGTGCACAGAATGTGTGCTTCTGGCCGCCATGGCCTAT
GACCGGTATGTGGCCATCTGTCGCCCACTCCACTACCCAACCATAATGAGCCATGGGCTC
TGCTTCCGCCTCGCTCTTGGTTCCTGGGCCATTGGCTTTGGCATCTCCCTGGCGAAGATC
TACTTCATCTCCTGCCTCAGCTTCTGTGGTCCCAATGTCATCAACCACTTCTTCTGTGAC
ATCTCTCCAGTACTTAATCTCTCCTGCACAGACATGTCCATAACTGAGTTGGTAGACTTT
ATCCTGGCACTGGTCATCTTCCTATTCCCACTCTTTATTACTGTCCTGTCCTACGGATGC
ATTCTGGCCACCATATTATGCATGCCCACAGGAAAGCAGAAAGCGTTCTCCACTTGTGCC
TCCCATCTTGTGGTGGTCACCATTTTCTATTCAGCCATTATTTTCATGTATGCTCGACCT
CGAGTTATCCATGCCTTCAACATGAACAAAATTATTTCCATCTTCTATGCCATTGTCACT
CCTTCTCTCAACCCTTTCATTTATTGCCTAAGAAACCGAGAGGTCAAGGAAGCTCTGAAG
AAACTGGCATATTGCCAGGCCAGCAGATCTGAC
Conceptual translation MELENQTRVTKFILVGFPGSLSMRAAMFLIFLVAYILTVAENVIIILLVLQNRPLHKPMY
FFLANLSFLETWYISVTVPKLLFSFWSVNNSISFTLCMIQLYFFIALMCTECVLLAAMAY
DRYVAICRPLHYPTIMSHGLCFRLALGSWAIGFGISLAKIYFISCLSFCGPNVINHFFCD
ISPVLNLSCTDMSITELVDFILALVIFLFPLFITVLSYGCILATILCMPTGKQKAFSTCA
SHLVVVTIFYSAIIFMYARPRVIHAFNMNKIISIFYAIVTPSLNPFIYCLRNREVKEALK
KLAYCQASRSD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS C/T R/C 1000GP (YRI, YRI)
7 100 -100 SYN C/T I/I 1000GP (YRI, YRI)
7 143,701,224 143,701,224 SYN C/T I/I rs61736970 (DbSNP)
7 143,701,471 143,701,471 NS C/T R/C rs28532725 (DbSNP)
7 143,701,516 143,701,516 NS C/T R/C rs7787378 (DbSNP)
7 143,701,726 143,701,726 NS A/G I/V rs61731391 (DbSNP)
7 143,701,884 143,701,884 SYN C/T A/A rs728275 (DbSNP)
7 144,004,423 144,004,423 NS C/T R/C 1000GP (CEU, CHBJPT)
7 144,004,791 144,004,791 SYN C/T A/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,208,034 143,736,035 CopyNumber Variation_5247 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,615,165 143,744,519 CopyNumber Variation_0110 (DGV)
7 143,677,645 143,716,639 CopyNumber Variation_36642 (DGV)
7 143,700,990 143,704,022 CopyNumber #113 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A117T R128C R143C A307S % Freq CORP
1 A R R A 83.56 0.078
2 A R C A 14.21 0.078
3 A C R A 1.38 0.078
4 T R C A 0.38 0.078
5 T R R A 0.31 0.078
6 A C C A 0.08 0.078
7 A R R S 0.08 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6B1.aApr07-unspliced main_exon CDS chr7 144,003,997 144,004,929 +
3UTR chr7 144,004,929 144,004,983 +