Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6B3 Olfactory Receptor

Gene Symbol OR6B31 (View this gene in GeneCards)
Family 6
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.38 (functional)
Aliases OR2-2, HsOR2.4.2
External Ids HGNC: 15042   GeneBank: AB065662, AF399471, BK004289, NM_173351   
Build #39 labels OR6B3
Chromosomal location 2:240,045,080-240,046,072 (-)
Cluster 2@241
Synteny CLIC#7
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6B2 95.44% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6B2 83% 306
Dog OR6B2C 82% 306
Dog OR6B2D 81% 306
Chimp CONTIG1089.72-11320 96% 332
Chimp CONTIG1089.75-187 95% 203
Mouse Or6b3 88% 307
Mouse Or6b2 85% 307
Mouse Or6b2b 85% 307
Rat Or6b3 87% 309
Rat Or6b2b 85% 307
Rat Or6b2 84% 309
Cow OR6B2 85% 303
Cow OR6B3 83% 306

Expression evidences

Source Accession
GNF Atlas2 gnf1h10927_at

Sequence information

Nucleotide sequence ATGAGTGGGGAGAATGTCACCAGGGTCGGCACCTTCATCCTGGTGGGCTTCCCCACGGCC
CCAGGGCTGCAGTACCTGCTCTTCCTCCTCTTCCTGCTCACCTACCTCTTTGTCCTGGTG
GAGAACCTGGCCATCATCCTCACCGTCTGGAGCAGCACCTCCCTCCACAGGCCCATGTAC
TACTTTCTGAGCTCCATGTCTTTCCTAGAGATCTGGTACGTGTCTGACATCACCCCCAAG
ATGCTGGAGGGCTTCCTCCTCCAGCAGAAACGCATCTCTTTCGTCGGGTGCATGACGCAG
CTCTACTTCTTCAGCTCCCTGGTGTGCACCGAGTGTGTGCTTCTGGCCTCCATGGCCTAC
GACCGCTACGTGGCCATCTGCCACCCGCTGCGCTACCACGTCCTTGTGACCCCGGGGCTG
TGCCTCCAGCTGGTGGGCTTCTCCTTTGTGAGTGGCTTCACCATCTCCATGATCAAGGTC
TGTTTTATCTCCAGCGTCACGTTCTGTGGCTCCAACGTCTTGAACCACTTCTTCTGTGAC
ATTTCCCCCATCCTCAAGCTGGCCTGCACGGACTTCTCCACTGCAGAGCTGGTGGATTTC
ATTCTGGCCTTCATCATCCTGGTGTTTCCACTCCTGGCCACCATGCTGTCATATGCGCAC
ATCACCCTGGCTGTCCTGCGCATCCCCTCGGCCACCGGCTGCTGGAGAGCCTTCTTCACC
TGCGCCTCTCACCTCACCGTGGTCACCGTCTTCTATACAGCCTTGCTTTTCATGTATGTC
CGGCCCCAGGCCATTGATTCCCGGAGCTCCAACAAGCTCATCTCTGTTTTGTACACAGTT
ATCACCCCCATCTTGAACCCCTTGATATACTGCCTGAGGAATAAGGAATTTAAGAATGCC
TTGAAAAAAGCCTTCGGCTTGACGAGCTGCGCCGTAGAGGGGAGGCTTTCTAGTCTTCTG
GAACTTCATCTCCAAATACACAGCCAGCCTCTC
Conceptual translation MSGENVTRVGTFILVGFPTAPGLQYLLFLLFLLTYLFVLVENLAIILTVWSSTSLHRPMY
YFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAY
DRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCD
ISPILKLACTDFSTAELVDFILAFIILVFPLLATMLSYAHITLAVLRIPSATGCWRAFFT
CASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISVLYTVITPILNPLIYCLRNKEFKNA
LKKAFGLTSCAVEGRLSSLLELHLQIHSQPL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
2 240,985,347 240,985,347 NS A/G I/T rs13030992 (DbSNP)
2 240,984,789 240,984,789 NS C/T C/Y rs12465491 (DbSNP)
2 240,984,827 240,984,827 SYN A/G I/I rs72993519 (DbSNP)
2 240,984,833 240,984,833 SYN C/G A/A rs13389099 (DbSNP)
2 240,045,416 240,045,416 SYN C/G A/A 1000GP (CEU, CHBJPT)
2 240,045,410 240,045,410 SYN G/A I/I 1000GP (CEU)
2 240,045,930 240,045,930 NS G/A T/I 1000GP (CEU)
2 100 -100 NS C/T G/S 1000GP (YRI)
2 100 -100 SYN C/G A/A 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
2 240,911,276 241,082,695 CopyNumber Variation_0031 (DGV)
CopyNumber 193 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G306S R261W C234Y % Freq CORP
1 G R C 63.82 0.559
2 G R Y 35.87 0.559
3 S R C 0.23 0.559
4 G W Y 0.08 0.559

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6B3.aApr07-unspliced main_exon 3UTR chr2 240,045,077 240,045,080 -
CDS chr2 240,045,080 240,046,072 -