Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C2 Olfactory Receptor

Gene Symbol OR6C21 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases HSA3, HsOR12.5.19, ORL3812
External Ids HGNC: 15436   GeneBank: AF179766, NM_054105, XM_498546   ORDB: ORL3812   
Build #39 labels OR6C2
Chromosomal location 12:55,452,214-55,453,149 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C68 74.68% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C2 88% 312
Dog OR6C2E 87% 312
Dog OR6C2D 87% 312
Dog OR6C2IP 85% 313
Chimp CONTIG*********** 75% 312
Mouse Or6c2 90% 312
Rat Or6c2 89% 312
Rat Or6c2c 88% 291
Cow OR6C2 82% 308

Expression evidences

Source Accession
ESTs BG205103
mRNA AB528770

Sequence information

Nucleotide sequence ATGAAAAACCACACAGTAATAAGAACTTTTATCCTGCTGGGACTGACAGGTGACCCACAC
CTGCAAGTTCTGCTTTTTATCTTTCTATTTCTCACCTACATGTTGAGTGTAACAGGGAAC
CTGACTATTATCACCCTCACATTGGTGGACCACCACCTTAAAACTCCTATGTACTTCTTT
CTCAGAAATTTTTCCTTCTTAGAAGTCTCATTTACTACAGTCTGCATTCCCAGATTCTTG
TACAATATATCAATGGGGGACAATACCATTACCTACAATGCTTGTGCCAGTCAAATATTC
TTTGTTATTCTCTTTGGAGCAACAGAATTTTTTCTCTTGGCAGCCATGTCCTATGACCGC
TATGTGGCCATCTGTAAACCCCTTCATTATGTGGTCATCATGAACAACAGGGTGTGTACC
TTATTAGTTCTCTGCTGTTGGGTGGCTGGCTTGATGATCATTGTTCCACCACTTAGCTTA
GGCCTCCAGCTCGAATTCTGTGACTCCAATGCCATTGATCATTTTAGCTGTGATGCAGGT
CCTCTCCTAAAGATCTCATGCTCAGATACATGGGTAATAGAACAGATGGTTATACTTATG
GCTGTATTTGCACTCATTATCACCCTAGTTTGTGTGATTCTGTCCTACTTGTACATAGTC
AGAACAATTCTGAAGTTCCCTTCTGTTCAGCAAAGGAAAAAGGCCTTTTCTACCTGTTCA
TCCCACATGATTGTGGTTTCCATTGCCTATGGAAGCTGCATCTTCATCTATATCAAGCCC
TCTGCAAAAGATGAGGTGGCCATAAATAAAGGAGTTTCAGTTCTTACTACTTCTGTCGCA
CCCTTGTTGAACCCCTTCATTTACACCTTGAGGAACAAGCAAGTGAAACAAGCTTTCAGT
GACTCTATAAAGAGGATTGCATTTCTCTCAAAGAAG
Conceptual translation MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR
YVAICKPLHYVVIMNNRVCTLLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAG
PLLKISCSDTWVIEQMVILMAVFALIITLVCVILSYLYIVRTILKFPSVQQRKKAFSTCS
SHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS
DSIKRIAFLSKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS A/G I/V 1000GP (YRI, YRI, YRI, YRI, YRI)
12 100 -100 SYN C/T L/L 1000GP (YRI, YRI)
12 55,452,754 55,452,754 NS C/G P/A 1000GP (CHBJPT)
12 55,452,839 55,452,839 NS T/C L/P 1000GP (CEU)
12 55,453,010 55,453,010 NS T/A V/E 1000GP (CEU)
12 55,846,204 55,846,203 Ins(1) -/G rs34885470 (DbSNP)
12 55,846,538 55,846,538 NS C/G P/A rs11171466 (DbSNP)
12 55,846,623 55,846,623 NS C/T P/L rs11171467 (DbSNP)
12 55,846,649 55,846,649 NS G/T D/Y rs12817326 (DbSNP)
12 55,846,731 55,846,731 NS G/T G/V rs12810501 (DbSNP)
12 55,846,773 55,846,773 NS A/G K/R rs73339457 (DbSNP)
12 55,846,890 55,846,890 NS C/T A/V rs74092333 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
12 55,832,210 56,001,052 CopyNumber Variation_4780 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I154V P181A L209P Q231H I244T K259R V266E A298V % Freq CORP
1 I P L Q I K V A 80.49 0.131
2 I P P Q I K V A 10.75 0.131
3 I A L Q I K V A 2.69 0.131
4 I P L Q I R V A 2.38 0.131
5 I P L Q I K V V 2.15 0.131
6 I P L Q T K V A 1.00 0.131
7 I P L H I K V A 0.15 0.131
8 I P P Q I K E A 0.15 0.131
9 I P L Q I R V V 0.15 0.131
10 V P P Q I K V A 0.08 0.131

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C2.aApr07-unspliced main_exon CDS chr12 55,452,214 55,453,149 +
3UTR chr12 55,453,149 55,453,152 +