Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C4 Olfactory Receptor

Gene Symbol OR6C41 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases OR12-10, HsOR12.5.23
External Ids HGNC: 19632   GeneBank: AB065869, BK004261, NM_001005494   
Build #39 labels OR6C4
Chromosomal location 12:55,551,227-55,552,153 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AP1 80.26% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C4 90% 309
Chimp CONTIG*********** 99% 309
Mouse Or2ap1 77% 309
Rat Or6c63 76% 309
Cow OR6C4 91% 309
Cow OR6C4C 91% 308

Expression evidences

Source Accession
mRNA BC137001

Sequence information

Nucleotide sequence ATGAAAAACAGAACCATGTTTGGTGAGTTTATTCTACTGGGCCTTACAAATCAACCTGAA
CTCCAAGTGATGATATTCATCTTTCTGTTCCTCACCTACATGCTAAGTATCCTAGGAAAT
CTGACTATTATCACCCTCACCTTACTAGACCCCCACCTCCAGACCCCCATGTATTTCTTC
CTCCGGAATTTCTCCTTCTTAGAAATTTCCTTCACATCCATTTTTATTCCCAGATTTCTG
ACCAGCATGACAACAGGAAATAAAGTTATCAGCTTTGCTGGCTGCTTGACTCAGTATTTT
TTTGCTATATTTCTTGGAGCTACCGAGTTTTACCTCCTGGCCTCCATGTCTTATGATCGT
TATGTGGCCATCTGCAAACCCTTGCATTACCTGACTATTATGAGCAGCAGAGTCTGCATA
CAACTAGTGTTCTGCTCCTGGTTGGGGGGATTCCTAGCAATCTTACCACCAATCATCCTG
ATGACCCAGGTAGATTTCTGTGTCTCCAACATTCTGAATCACTATTACTGTGACTATGGG
CCTCTCGTGGAGCTTGCCTGCTCAGACACAAGCCTCTTAGAACTGATGGTCATCCTCTTG
GCCGTTGTGACTCTCATGGTTACTCTGGTGCTGGTGACACTTTCTTACACATACATTATC
AGGACTATTCTGAGGATCCCTTCTGCCCAGCAAAGGACAAAGGCCTTTTCCACTTGTTCC
TCCCACATGATTGTCATCTCCCTCTCTTATGGCAGCTGCATGTTTATGTACATTAATCCT
TCTGCAAAAGAAGGAGGTGCTTTCAACAAAGGAATAGCTGTACTCATTACTTCGGTTACT
CCCTTACTGAATCCCTTCATATATACTTTAAGAAATCAGCAAGTGAAACAAGCTTTCAAG
GACTCAGTCAAAAAGATTGTGAAACTT
Conceptual translation MKNRTMFGEFILLGLTNQPELQVMIFIFLFLTYMLSILGNLTIITLTLLDPHLQTPMYFF
LRNFSFLEISFTSIFIPRFLTSMTTGNKVISFAGCLTQYFFAIFLGATEFYLLASMSYDR
YVAICKPLHYLTIMSSRVCIQLVFCSWLGGFLAILPPIILMTQVDFCVSNILNHYYCDYG
PLVELACSDTSLLELMVILLAVVTLMVTLVLVTLSYTYIIRTILRIPSAQQRTKAFSTCS
SHMIVISLSYGSCMFMYINPSAKEGGAFNKGIAVLITSVTPLLNPFIYTLRNQQVKQAFK
DSVKKIVKL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS A/G I/V 1000GP (YRI, YRI, YRI)
12 100 -100 SYN A/G T/T 1000GP (YRI, YRI)
12 55,551,335 55,551,335 NS A/G I/V 1000GP (CEU, CHBJPT)
12 55,551,474 55,551,474 NS T/C M/T 1000GP (CHBJPT)
12 55,551,762 55,551,762 NS A/G Y/C 1000GP (CHBJPT)
12 55,552,072 55,552,072 SYN A/G L/L 1000GP (CHBJPT)
12 55,945,119 55,945,119 NS A/G I/V rs7313899 (DbSNP)
12 55,945,219 55,945,219 NS C/T S/F rs58154171 (DbSNP)
12 55,945,258 55,945,258 NS C/T T/M rs11835716 (DbSNP)
12 55,945,265 55,945,265 SYN A/G T/T rs74093226 (DbSNP)
12 55,945,585 55,945,588 Del(4) -/TCTT rs59693527 (DbSNP)
12 55,945,856 55,945,856 SYN A/G L/L rs57386660 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 19 (Hasin)
12 55,832,210 56,001,052 CopyNumber Variation_4780 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I37V S70F M83T E109K Y179C L205F V210M Q230K N269I Q297* % Freq CORP
1 V S M E Y L V Q N Q 85.64 0.244
2 V S T E Y L V Q N Q 9.75 0.244
3 V F T E Y L V Q N Q 1.77 0.244
4 I S M E Y L V Q N Q 0.84 0.244
5 V S T K Y L V Q N Q 0.77 0.285
6 V F T E Y L V K N Q 0.38 0.244
7 V S M E Y F V Q N Q 0.31 0.244
8 V F T E Y L V Q I Q 0.15 0.244
9 V S M E Y L V Q N * 0.08 1.200
10 V S T E C L V Q N Q 0.08 0.244
11 V S M E C L V Q N Q 0.08 0.244
12 V S M E Y L M Q N Q 0.08 0.244
13 I S T E Y L V Q N Q 0.08 0.244

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C4.aApr07-unspliced main_exon CDS chr12 55,551,227 55,552,153 +
3UTR chr12 55,552,153 55,552,156 +