Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C64P Olfactory Receptor

Gene Symbol OR6C64P1 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR12.5.22P
External Ids HGNC: 31294   GeneBank: NG_004429   
Build #39 labels
Chromosomal location 12:55,522,593-55,523,471 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C2 66.24% 311
OR6C68 63.36% 292
OR6C74 60.78% 283

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C38 81% 312
Dog OR6C85 80% 312
Dog OR6C94P 81% 274
Mouse Or6c38 80% 312
Rat Or6c38 80% 312
Cow OR6C288 81% 312
Orang OR6C312P 81% 291
Horse OR6C322 79% 312
Chimp OR6C68 65% 284

Sequence information

Nucleotide sequence ATGAAATATTATACAACAATAAAAACACTTATCCTGGTGGGACTAACAGATGACACAAAT
CTACAGATTCTGCTTTTTATCTTCTTGTTTCTAACCTATTTGTTAAGTGTTGTTGGAAAT
TTGACCATCATGACGTTCACTTTTGTGGACTCCCACCTTAAAACACCTATGTATTTTTTC
CTCCGGAATTTTTCCATCTTGGAAGTCTCATTTACAACTGTGTGAATTCCCAGATTTCTC
TACACAATGGCATCTGGGGAAAATACTGTTACCTATAATGCATGTGCCACTCAATTGTTT
TTTGTTGTTGTCCTGGGTGTGACTGAGTTTTTTCTCCTAACAGCTATGTCCTATGATCGT
TATGTAGCCATCTGCAAACCCCTGCATTACACGACCATCATGAACAACAGAGTTTGCATC
AAGTTCCTCACTGGCTGTCATATAATTCCTCTAATCATTGTCATCCCACCATTTGGCATG
GGCTTTGAGCTTGAATTTTGTGACTCCAATGTCATAGATCACTTTGACTGTGATGCTGCC
CCCATCCTGAAGATTACCTGCTCTAACACAGAGTTTATAGAGCGATTTGTATTAGTCTTG
GTGGTGTTGACACTCCTGTTTACCTTGGTGTGTGTGATTATGTCCTACACTTACATCATC
AGGACCATTCTCAGATTCCCTTCTGCCCAGCAAAGGAAAAAGGCTTTTTGCACTTGCTCT
TCCCATATAATTGTGGTTTCTATCACTTATGGAAGCTGCATCTTTATCTATGTTAAACCA
TCTGCAAAAGAAGAGGTAGCTATTAACAAGGTGGTGTCAGTGCTGATACAGGCTTTCAAA
GACATGATCAAAAGGATTGCATCTATCTCAAAAAACTAA
Conceptual translation MKYYTTIKTLILVGLTDDTNLQILLFIFLFLTYLLSVVGNLTIMTFTFVDSHLKTPMYFF
LRNFSILEVSFTTVXPRFLYTMASGENTVTYNACATQLFFVVVLGVTEFFLLTAMSYDR
YVAICKPLHYTTIMNNRVCIKFLTGCHIIPLIIVIPPFGMGFELEFCDSNVIDHFDCDAA
PILKITCSNTEFIERFVLVLVVLTLLFTLVCVIMSYTYIIRTILRFPSAQQRKKAFCTCS
SHIIVVSITYGSCIFIYVKPSAKEEVAINKVVSVLIQAFKDMIKRIASISKN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 SNP T/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
12 55,522,599 55,522,599 SNP T/A 1000GP (CEU, CHBJPT)
12 55,522,853 55,522,853 SNP A/C 1000GP (CEU)
12 55,522,996 55,522,996 SNP A/G 1000GP (CEU, CHBJPT)
12 55,523,116 55,523,116 SNP T/G 1000GP (CEU)
12 55,916,383 55,916,383 SNP A/T rs10783755 (DbSNP)
12 55,916,637 55,916,637 SNP C/A rs4513498 (DbSNP)
12 55,916,717 55,916,717 SNP C/T rs73324296 (DbSNP)
12 55,916,780 55,916,780 SNP A/G rs12230513 (DbSNP)
12 55,916,900 55,916,900 SNP T/G rs4301049 (DbSNP)
12 55,917,007 55,917,007 SNP G/T rs55978845 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 18 (Hasin)
12 55,832,210 56,001,052 CopyNumber Variation_4780 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.