Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C74 Olfactory Receptor

Gene Symbol OR6C741 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR12.5.6
External Ids HGNC: 31303   GeneBank: NM_001005490   
Build #39 labels
Chromosomal location 12:55,247,288-55,248,223 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C66P 73.77% 305
OR6C75 72.99% 311
OR6C76 73.53% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C74 88% 312
Chimp CONTIG*********** 97% 305
Mouse Or6c74 89% 310
Rat Or6c74b 88% 312
Rat Or6c74 88% 312
Cow OR6C74 87% 312
Cow OR6C74C 88% 312

Expression evidences

Source Accession
mRNA BC140754

Sequence information

Nucleotide sequence ATGAGAAACCATACAACAGTAGCAAACTTTATTCTTCTTGGACTGACAGATGATCCACAA
TTACAGGTGATTATTTTTCTTCTCCTTTTTTTCACCTACATGTTGAGCATCACTGGGAAT
CTAACCATCATCACTCTCACCCTACTGGATTTGCATCTCAAGACACCCATGTATTTCTTC
CTCCGAAATTTCTCATTTTTAGAAGTCTCATTCACAACTGTCTACATTCCCAAATTTCTT
GTTAGTATGGCAACAGGTGATAAGACCATTTCTTACAACGATTGTGCAGCACAGCTGTTT
TTCACTATTCTCTTGGGGGCAACTGAATTTTTTCTTCTGGCTGCCATGTCCTATGAGCGC
TATGTGGCCATCTGCAAACCCCTGCATTACACCACCATCATGAGCAGCAGAGTTTGCAGC
TTGCTGGTCTTTGCTTCATGGATGGCTGGCTTCCTAATAATTTTTCCGCCACTCCTGATG
GGTCTCCAGCTTGATTTCTGTGCAGCCAACACTGTAGATCATTTCTTCTGTGATGTTTCT
CCTATACTGCAGCTCTCTTGCACAGACACTGACATAATAGAATTAATGATGCTTCTCTCA
GCCATTTTGACGCTCCTGGTTACACTGGTATTAGTGATTCTCTCCTACACAAATATTATC
AGGACTATTCTGAAAATACCTTCTTCTCAACAGAGAAAAAAAGCATTTTCTACATGTTCT
TCCCACATGGTGGTCGTGTCCATTTCTTATGGCAGCTGCATCTTCATGTATGTGAAACCC
TCAGCAAAAGAAAGAGTGTCATTAAATAAAGGGATAGCTCTGCTCAGCACTTCTGTTGCC
CCCATGTTGAATCCCTTTATTTATACACTGAGAAACAAACAAGTAAAAGATGTTTTTAAG
CACACAGTCAAAAAGATTGAACTTTTCTCAATGAAA
Conceptual translation MRNHTTVANFILLGLTDDPQLQVIIFLLLFFTYMLSITGNLTIITLTLLDLHLKTPMYFF
LRNFSFLEVSFTTVYIPKFLVSMATGDKTISYNDCAAQLFFTILLGATEFFLLAAMSYER
YVAICKPLHYTTIMSSRVCSLLVFASWMAGFLIIFPPLLMGLQLDFCAANTVDHFFCDVS
PILQLSCTDTDIIELMMLLSAILTLLVTLVLVILSYTNIIRTILKIPSSQQRKKAFSTCS
SHMVVVSISYGSCIFMYVKPSAKERVSLNKGIALLSTSVAPMLNPFIYTLRNKQVKDVFK
HTVKKIELFSMK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 nonsense SNP C/T R/* 1000GP (YRI)
12 100 -100 NS A/G R/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
12 100 -100 SYN G/A L/L 1000GP (YRI, YRI, YRI)
12 55,247,291 55,247,291 NS A/G R/G 1000GP (CEU, CHBJPT)
12 55,247,471 55,247,471 nonsense SNP C/T R/* 1000GP (CEU, CHBJPT)
12 55,247,511 55,247,511 NS A/G Y/C 1000GP (CEU, CHBJPT)
12 55,247,544 55,247,544 NS G/A G/D 1000GP (CEU, CHBJPT)
12 55,247,547 55,247,547 NS A/T D/V 1000GP (CHBJPT)
12 55,247,645 55,247,645 NS C/T R/C 1000GP (CHBJPT)
12 55,247,966 55,247,966 NS C/T P/S 1000GP (CEU)
12 55,248,027 55,248,027 NS C/T S/F 1000GP (CEU)
12 55,248,136 55,248,136 SYN G/A L/L 1000GP (CHBJPT)
12 55,641,075 55,641,075 NS A/G R/G rs7301705 (DbSNP)
12 55,641,218 55,641,218 SYN A/G L/L rs11171387 (DbSNP)
12 55,641,252 55,641,252 NS C/T L/F rs11171388 (DbSNP)
12 55,641,255 55,641,255 nonsense SNP C/T R/* rs4522268 (DbSNP)
12 55,641,263 55,641,263 SYN C/T F/F rs11171389 (DbSNP)
12 55,641,295 55,641,295 NS A/G Y/C rs4388990 (DbSNP)
12 55,641,328 55,641,328 NS A/G D/G rs6581025 (DbSNP)
12 55,641,429 55,641,429 NS C/T R/C rs4321039 (DbSNP)
12 55,641,920 55,641,920 SYN A/G L/L rs73322883 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 106 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R2G L61F R62* Y75C G86D D87V R120C S247F % Freq CORP
1 R L R Y G D R S 69.59 1.000
2 G L * C D D R S 18.97 1.200
3 R F R Y G D R S 6.14 1.000
4 R L * C G D C S 1.84 1.200
5 G L * C D D R F 1.15 1.200
6 R L R Y D D R S 1.00 1.000
7 R L R Y G V R S 0.61 1.000
8 G L * Y D D R F 0.23 1.200
9 G L * C G D R S 0.15 1.200
10 G L R Y G D R S 0.08 1.000
11 R L * Y G D R S 0.08 1.200
12 G L * Y G D R F 0.08 1.200
13 G L R C D D R S 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C74.aApr07-unspliced main_exon CDS chr12 55,247,288 55,248,223 +
3UTR chr12 55,248,223 55,248,226 +