Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6E1P Olfactory Receptor

Gene Symbol OR6E1P1 (View this gene in GeneCards)
Family 6
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR14.3.2P, ORL3703
External Ids HGNC: 14739   GeneBank: AF399346, NG_002244   ORDB: ORL3703   
Build #39 labels OR6E1P
Chromosomal location 14:22,702,143-22,703,068 (+)
Cluster 14@23
Synteny CLIC#36
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AP1 53.9% 308
OR6C3 52.94% 306
OR6C4 53.25% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6E1 84% 308
Chimp CONTIG866.43-4710 96% 309
Mouse Or6e1 80% 306
Rat Or6e1 78% 309
Cow OR6E1 84% 307
Cow OR6E1B 84% 306
Cow OR6E1C 83% 306
Cow OR6E1D 82% 307
Cow OR6E1E 82% 307

Expression evidences

Source Accession
ESTs BF363311

Sequence information

Nucleotide sequence ATGGGGAACCACACCACCGTCACCGAGTTTGTCCTGCTGGGGCTCTCAGAGACCTGTGAG
CTGCAGATGCTCATCTTCCTGGGGCTCCTCCTGACCTACCTCCTCACACTGCTGGGGAAT
CTGGTCATCGTGGTCATCACCCTCATGGACAGGCGCCTCCACACCACCATGTACTACTTC
CTCCGCAACTTTGCTGTCCCGGAGATCTGGTTCACCTCGGTCATCTTTCCCAAGGTGCTG
GCCAACATCCTCACAGGATACAAGACCATTCCCTCCCAGGCTGCTTCCTGCAAAGTTTGC
TCTATTTTTTCTTGGGCACCACAGAGTTCTTCCTCCTGGCGGTGATGTCCTTTGACAGGT
ACGTGGCCGTATGTAACCCTTTGCATTATGCCACCATCATGAGCAAAAGGGTCTGTGTCC
AGCTAGTCCTCTGTTAGTGGATGACAGGATTCCTTCTCATCATTATTCCAAGTTTTCTTG
TCCTTCAGCAGCCATTCTGTGGCCCCAACATCATTAACCATTTCTTCTGTGACAACTTTC
CCCTCTTGAAACTCATTTGTGCAGACATGACTCTGATAGAGCTCCTGGGTTTTGTTATAG
CCAACGTCAGCTTACTGGGCACTCTGTCTATGACGGCCACTTGCTATGGCCACATCCTCC
ACGCCATTCTGCACATCCCCTCAGCCAAAGAGAAGCAGAAAGCCTTCTCCGCCTGCTCCT
CCCACATCATTGTCGTGTCTCTCTTCTATGGCAGCTGCATCTTCATGTACATTCAGTCAG
GCAAGAGTGACCAGAAGGAAGACAGGAACAAGGTGGCGGCATTGCTTAACACCGTGGTGA
CCCTGATGCTCAACCCCTTCATCTACACCCTGAGGAACAAACAGGTGAAACAGGTGTTTA
GGCAGCAGGTGAGCAAACTCCTCATA
Conceptual translation MGNHTTVTEFVLLGLSETCELQMLIFLGLLLTYLLTLLGNLVIVVITLMDRRLHTTMYYF
LRNFAVPEIWFTSVIFPKVLANILTGYKT/SLPGCFLQSLLYFFLGTTEFFLLAVMSFD
RYVAVCNPLHYATIMSKRVCVQLVLCXMTGFLLIIIPSFLVLQQPFCGPNIINHFFCDN
FPLLKLICADMTLIELLGFVIANVSLLGTLSMTATCYGHILHAILHIPSAKEKQKAFSAC
SSHIIVVSLFYGSCIFMYIQSGKSDQKEDRNKVAALLNTVVTLMLNPFIYTLRNKQVKQV
FRQQVSKLLI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
14 22,702,410 22,702,410 SNP A/G 1000GP (CEU, CHBJPT)
14 22,702,959 22,702,959 SNP C/T 1000GP (CEU, CHBJPT)
14 22,703,045 22,703,045 SNP C/G 1000GP (CEU, CHBJPT)
14 22,703,053 22,703,053 SNP G/A 1000GP (CHBJPT)
14 23,171,569 23,171,569 SNP C/T rs73589355 (DbSNP)
14 23,171,619 23,171,619 SNP A/G rs10136922 (DbSNP)
14 23,172,160 23,172,160 SNP A/C rs11157751 (DbSNP)
14 23,172,168 23,172,168 SNP C/T rs7159259 (DbSNP)
14 23,172,254 23,172,254 SNP C/G rs4981432 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 23,160,194 23,259,699 CopyNumber Variation_49325 (DGV)
14 23,171,252 23,174,277 CopyNumber #91 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6E1P.aApr07-unspliced main_exon CDS_partial chr14 22,702,356 22,702,581 +