Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6F1 Olfactory Receptor

Gene Symbol OR6F11 (View this gene in GeneCards)
Family 6
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.11 (functional)
Aliases OR1-38, OR1-34, HsOR1.5.7, ORL3020
External Ids HGNC: 15027   GeneBank: AB065619, AF399604, AY284133-AY284164, BK004460, BK004745, NM_001005286   ORDB: ORL3020   
Build #39 labels OR6F1
Chromosomal location 1:247,711,832-247,712,755 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6A2 50.85% 295
OR6M1 52.68% 298
OR6N1 51.96% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6F1 90% 308
Chimp CONTIG658.54-13632 98% 308
Mouse Or6f1 83% 308
Rat Or6f1b 84% 306
Rat Or6f1 84% 306
Cow OR6F1 90% 308

Expression evidences

Source Accession
ESTs DB336294
mRNA BC137143
GNF Atlas2 gnf1h07039_at

Sequence information

Nucleotide sequence ATGGACACAGGCAACAAAACTCTGCCCCAGGACTTTCTCTTACTGGGCTTTCCTGGTTCT
CAAACTCTTCAGCTCTCTCTCTTTATGCTTTTTCTGGTGATGTACATCCTCACAGTTAGT
GGTAATGTGGCTATCTTGATGTTGGTGAGCACCTCCCATCAGTTGCATACCCCCATGTAC
TTCTTTCTGAGCAACCTCTCCTTCCTGGAGATTTGGTATACCACAGCAGCAGTGCCCAAA
GCACTGGCCATCCTACTGGGGAGAAGTCAGACCATATCATTTACAAGCTGTCTTTTGCAG
ATGTACTTTGTTTTCTCATTAGGCTGCACAGAGTACTTCCTCCTGGCAGCCATGGCTTAT
GACCGCTGTCTTGCCATCTGCTATCCTTTACACTACGGAGCCATCATGAGTAGCCTGCTC
TCAGCGCAGCTGGCCCTGGGCTCCTGGGTGTGTGGTTTCGTGGCCATTGCAGTGCCCACA
GCCCTCATCAGTGGCCTGTCCTTCTGTGGCCCCCGTGCCATCAACCACTTCTTCTGTGAC
ATTGCACCCTGGATTGCCCTGGCCTGCACCAACACACAGGCAGTAGAGCTTGTGGCCTTT
GTGATTGCTGTTGTGGTTATCCTGAGTTCATGCCTCATCACCTTTGTCTCCTATGTGTAC
ATCATCAGCACCATCCTCAGGATCCCCTCTGCCAGTGGCCGGAGCAAAGCCTTCTCCACG
TGCTCCTCGCATCTCACCGTGGTGCTCATTTGGTATGGGTCCACAGTTTTCCTTCACGTC
CGCACCTCTATCAAAGATGCCTTGGATCTGATCAAAGCTGTCCACGTCCTGAACACTGTG
GTGACTCCAGTTTTAAACCCCTTCATCTATACGCTTCGTAATAAGGAAGTAAGAGAGACT
CTGCTGAAGAAATGGAAGGGAAAA
Conceptual translation MDTGNKTLPQDFLLLGFPGSQTLQLSLFMLFLVMYILTVSGNVAILMLVSTSHQLHTPMY
FFLSNLSFLEIWYTTAAVPKALAILLGRSQTISFTSCLLQMYFVFSLGCTEYFLLAAMAY
DRCLAICYPLHYGAIMSSLLSAQLALGSWVCGFVAIAVPTALISGLSFCGPRAINHFFCD
IAPWIALACTNTQAVELVAFVIAVVVILSSCLITFVSYVYIISTILRIPSASGRSKAFST
CSSHLTVVLIWYGSTVFLHVRTSIKDALDLIKAVHVLNTVVTPVLNPFIYTLRNKEVRET
LLKKWKGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G F/L 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN C/G V/V 1000GP (YRI, YRI, YRI)
1 247,712,012 247,712,012 SYN C/A V/V 1000GP (CEU)
1 247,712,113 247,712,113 NS A/G F/L 1000GP (CEU, CHBJPT)
1 247,712,281 247,712,281 NS G/C P/A 1000GP (CEU)
1 247,712,306 247,712,306 SYN C/G V/V 1000GP (CEU, CHBJPT)
1 247,712,387 247,712,387 SYN A/G C/C 1000GP (CEU, CHBJPT)
1 247,712,673 247,712,673 NS A/G F/S 1000GP (CEU)
1 247,875,313 247,875,313 NS G/A L/F rs61730474 (DbSNP)
1 247,875,314 247,875,314 SYN A/C V/V rs41268353 (DbSNP)
1 247,875,347 247,875,347 SYN G/T A/A rs61857829 (DbSNP)
1 247,875,415 247,875,415 NS G/A L/F rs2282316 (DbSNP)
1 247,875,543 247,875,543 NS T/C H/R rs61730473 (DbSNP)
1 247,875,583 247,875,583 NS C/G A/P rs6665599 (DbSNP)
1 247,875,608 247,875,608 SYN C/G V/V rs6587382 (DbSNP)
1 247,875,623 247,875,623 SYN G/A A/A rs61730472 (DbSNP)
1 247,875,682 247,875,682 NS T/C I/V rs61730471 (DbSNP)
1 247,875,689 247,875,689 SYN A/G C/C rs7512807 (DbSNP)
1 247,875,975 247,875,975 NS A/G F/S rs61730470 (DbSNP)
1 247,876,020 247,876,020 NS A/G L/P rs60303431 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 247,850,055 247,877,345 CopyNumber Variation_34793 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L249F F215L I181T R172H P159A V154M F62L F28S L13P % Freq CORP
1 L F I R P V F F L 61.98 0.106
2 L L I R P V F F L 20.05 0.106
3 L L I R A V F F L 6.61 0.106
4 L L I R A V F S L 4.38 0.106
5 L L I R A V F F P 2.07 0.106
6 L F I R A V F S L 1.46 0.106
7 L L I R A M F F L 1.31 0.106
8 L F I R P V F S L 0.69 0.106
9 L L I H P V F F L 0.61 0.106
10 F F I R P V F F L 0.46 0.106
11 L F I R P V L F L 0.15 0.106
12 L F T R P V F F L 0.08 0.106
13 L F T R A V F S L 0.08 0.106
14 F L I R P V F F L 0.08 0.106

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AX1andOR6F1.aApr07 main_exon 3UTR chr1 247,711,539 247,711,832 -
CDS_partial chr1 247,711,832 247,712,067 -
exon_5UTR chr1 247,734,219 247,734,425 -
exon_5UTR chr1 247,735,484 247,735,556 -
exon_5UTR chr1 247,747,871 247,748,140 -
OR5AX1andOR6F1.bApr07-unspliced main_exon 3UTR chr1 247,711,815 247,711,832 -
CDS chr1 247,711,832 247,712,755 -
OR5AX1andOR6F1.fApr07 main_exon CDS_partial chr1 247,711,947 247,712,087 -
exon_5UTR chr1 247,713,891 247,713,954 -
exon_5UTR chr1 247,723,651 247,723,764 -