Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6K2 Olfactory Receptor

Gene Symbol OR6K21 (View this gene in GeneCards)
Family 6
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.61 (pseudogene)
Aliases OR1-17, HsOR1.4.12, ORL3024
External Ids HGNC: 15029   GeneBank: AB065634, BK004196, NM_001005279   ORDB: ORL3024   
Build #39 labels OR6K2
Chromosomal location 1:158,699,681-158,700,652 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6K3 61.97% 305
OR6K4P 62.63% 297
OR6K6 63.12% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6K2 88% 314
Chimp CONTIG*********** 96% 325
Mouse Or6k2 87% 312
Rat Or6k2 87% 312
Cow OR6K2 86% 314

Expression evidences

Source Accession
mRNA BC137023

Sequence information

Nucleotide sequence ATGGAGAGCCCCAATCGAACCACCATTCAGGAGTTTATCTTCTCCGCTTTCCCTTATTCC
TGGGTTAAGTCTGTTGTCTGCTTTGTTCCACTGCTCTTCATCTATGCTTTCATTGTTGTT
GGAAACCTGGTCATCATCACAGTGGTCCAGTTGAATACTCACCTCCACACTCCCATGTAT
ACTTTTATCAGTGCTCTTTCTTTCCTGGAGATTTGGTATACCACAGCCACAATCCCAAAG
ATGCTGTCTAGCCTGCTTAGTGAGAGGAGCATTTCCTTCAATGGTTGTCTCCTGCAGATG
TATTTCTTCCATTCCACCGGCATCTGTGAGGTGTGTCTCTTGACAGTTATGGCCTTTGAC
CACTACCTGGCCATATGCAGCCCTCTTCATTATCCCTCTATCATGACCCCCAAGCTATGT
ACCCAACTGACTTTAAGTTGCTGTGTTTGTGGCTTTATCACACCCCTTCCTGAGATTGCC
TGGATCTCTACACTGCCATTTTGTGGTTCGAATCACCTTGAACATATCTTCTGTGACTTC
CTCCCAGTGCTGCGTCTGGCCTGCACAGACACACGAGCCATCGTCATGATTCAGGTAGTG
GATGTCATTCATGCAGTGGAGATTATTACAGCTGTGATGCTCATCTTCATGTCCTACGAT
GGTATTGTGGCTGTAATTCTACGTATTCATTCAGCTGGAGGCCGCCGCACAGCATTTTCC
ACGTGTGTCTCTCACTTCATTGTCTTTTCGCTCTTCTTTGGCAGTGTGACTCTCATGTAC
CTACGCTTCTCTGCCACCTACTCTTTGTTCTGGGATATAGCCATTGCTCTGGCCTTTGCA
GTTTTGTCTCCCTTCTTCAACCCCATTATCTATAGCCTGAGGAATAAAGAAATAAAAGAA
GCTATAAAAAAGCACATAGGTCAAGCTAAGATATTTTTTTCCGTAAGACCAGGGACCTCA
AGTAAGATATTT
Conceptual translation MESPNRTTIQEFIFSAFPYSWVKSVVCFVPLLFIYAFIVVGNLVIITVVQLNTHLHTPMY
TFISALSFLEIWYTTATIPKMLSSLLSERSISFNGCLLQMYFFHSTGICEVCLLTVMAFD
HYLAICSPLHYPSIMTPKLCTQLTLSCCVCGFITPLPEIAWISTLPFCGSNHLEHIFCDF
LPVLRLACTDTRAIVMIQVVDVIHAVEIITAVMLIFMSYDGIVAVILRIHSAGGRRTAFS
TCVSHFIVFSLFFGSVTLMYLRFSATYSLFWDIAIALAFAVLSPFFNPIIYSLRNKEIKE
AIKKHIGQAKIFFSVRPGTSSKIF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A R/C 1000GP (YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN A/G F/F 1000GP (YRI)
1 158,669,662 158,669,662 SYN A/G L/L rs41273535 (DbSNP)
1 158,669,684 158,669,684 SYN A/G F/F rs61322025 (DbSNP)
1 158,669,968 158,669,968 NS A/T F/I rs6686179 (DbSNP)
1 158,669,977 158,669,977 NS C/G V/L rs423141 (DbSNP)
1 158,670,426 158,670,426 NS T/C Q/R rs413029 (DbSNP)
1 158,699,872 158,699,872 SYN G/A L/L 1000GP (CEU)
1 158,699,992 158,699,992 NS C/T G/S 1000GP (CHBJPT)
1 158,700,009 158,700,009 NS A/T I/N 1000GP (CEU)
1 158,700,257 158,700,257 SYN G/A P/P 1000GP (CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R236C G221S I159F L156V P155S C140R S83F R6Q % Freq CORP
1 R G I L P C S R 88.63 0.678
2 R G F L P C S R 2.92 0.678
3 R S I L P C S R 2.92 0.678
4 R G I V P C S Q 2.53 0.678
5 R G I L S C S R 1.61 0.678
6 C G F L P C S R 0.77 0.678
7 R G I L P C S Q 0.31 0.678
8 R G I L P C F R 0.15 0.678
9 R G I L P R S R 0.15 0.678

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6K2.aApr07-unspliced main_exon 3UTR chr1 158,699,678 158,699,681 -
CDS chr1 158,699,681 158,700,652 -