Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6K3 Olfactory Receptor

Gene Symbol OR6K31 (View this gene in GeneCards)
Family 6
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR1-18, HsOR1.4.13, ORL3034
External Ids HGNC: 15030   GeneBank: AB065633, BK004197, NM_001005327   ORDB: ORL3034   
Build #39 labels OR6K3
Chromosomal location 1:158,717,171-158,718,115 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6K4P 80.61% 294

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6K3 86% 303
Chimp CONTIG*********** 97% 315
Mouse Or6k3 86% 293
Rat Or6k3-ps 87% 311
Cow OR6K4 81% 309

Sequence information

Nucleotide sequence ATGGAGAGCGGAAACCAATCAACAGTGACTGAATTTATCTTCACTGGATTCCCTCAGCTT
CAGGATGGTAGTCTCCTGTACTTCTTTCCTTTACTTTTCATCTATACTTTTATTATCATT
GATAACTTATTAATCTTCTCTGCTGTAAGGCTGGACACCCATCTCCACAACCCCATGTAT
AATTTTATCAGTATATTTTCCTTTCTGGAGATCTGGTACACCACAGCCACCATTCCCAAG
ATGCTCTCCAACCTCATCAGTGAAAAGAAGGCCATCTCAATGACTGGCTGCATCTTGCAG
ATGTATTTCTTCCACTCACTTGAAAACTCAGAGGGGATCTTGCTGACCACCATGGCCATT
GACAGATACGTTGCCATCTGCAACCCTCTTCGCTATCAAATGATCATGACCCCCCGGCTC
TGTGCTCAACTCTCTGCAGGTTCCTGCCTCTTCGGTTTCCTTATCCTGCTTCCCGAGATT
GTGATGATTTCCACACTGCCTTTCTGTGGGCCCAACCAAATCCATCAGATCTTCTGTGAC
TTGGTCCCTGTGCTAAGCCTGGCCTGTACAGACACGTCCATGATTCTGATTGAGGATGTG
ATTCATGCTGTGACCATCATCATTACCTTCCTAATCATTGCCCTGTCCTATGTAAGAATT
GTCACTGTGATATTGAGGATTCCCTCTTCTGAAGGGAGGCAAAAGGCTTTTTCTACCTGT
GCAGGCCACCTCATGGTCTTCCCGATATTCTTTGGCAGTGTATCACTCATGTACTTGCGT
TTCAGCGACACTTATCCACCAGTTTTGGACACAGCCATTGCACTGATGTTTACTGTACTT
GCTCCATTCTTCAATCCCATCATTTATAGCCTGAGAAACAAGGACATGAACAATGCGATT
AAAAAACTGTTCTGTCTTCAAAAAGTGTTGAACAAGCCTGGAGGT
Conceptual translation MESGNQSTVTEFIFTGFPQLQDGSLLYFFPLLFIYTFIIIDNLLIFSAVRLDTHLHNPMY
NFISIFSFLEIWYTTATIPKMLSNLISEKKAISMTGCILQMYFFHSLENSEGILLTTMAI
DRYVAICNPLRYQMIMTPRLCAQLSAGSCLFGFLILLPEIVMISTLPFCGPNQIHQIFCD
LVPVLSLACTDTSMILIEDVIHAVTIIITFLIIALSYVRIVTVILRIPSSEGRQKAFSTC
AGHLMVFPIFFGSVSLMYLRFSDTYPPVLDTAIALMFTVLAPFFNPIIYSLRNKDMNNAI
KKLFCLQKVLNKPGG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G V/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN C/T A/A 1000GP (YRI)
1 158,687,009 158,687,009 SYN C/T A/A rs857701 (DbSNP)
1 158,687,031 158,687,031 NS C/T R/K rs16840675 (DbSNP)
1 158,687,119 158,687,119 NS C/T D/N rs857702 (DbSNP)
1 158,687,163 158,687,163 NS A/G L/P rs28568406 (DbSNP)
1 158,687,224 158,687,224 NS A/G S/P rs857703 (DbSNP)
1 158,687,451 158,687,451 NS C/T G/D rs73030055 (DbSNP)
1 158,687,477 158,687,477 NS G/T H/Q rs857704 (DbSNP)
1 158,687,896 158,687,896 NS C/T G/R rs857705 (DbSNP)
1 158,717,373 158,717,373 NS G/A P/L 1000GP (CEU, CHBJPT)
1 158,717,434 158,717,434 NS G/A P/S 1000GP (CEU, CHBJPT)
1 158,717,687 158,717,687 SYN T/C Q/Q 1000GP (CHBJPT)
1 158,718,106 158,718,106 NS C/T G/R 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V309A D263N P248L P228S V200M G152D Q143H G96A G4R % Freq CORP
1 V D P P V G Q G G 40.86 0.029
2 V D L S V G Q G G 30.03 0.029
3 V D P P V G Q G R 18.59 0.029
4 V D L P V G Q G G 3.76 0.029
5 V N L P V G H G R 3.30 0.029
6 V D L P V D Q G G 2.23 0.029
7 A D P P V G Q G G 0.38 0.029
8 V D P P M G Q G G 0.31 0.029
9 V D P P V G Q A R 0.23 0.029
10 V D P P V D Q G G 0.15 0.029
11 V D P S V G Q G G 0.08 0.029
12 V N L P V G H G G 0.08 0.029

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6K3.aApr07-unspliced main_exon 3UTR chr1 158,717,168 158,717,171 -
CDS chr1 158,717,171 158,718,115 -
5UTR chr1 158,718,115 158,718,163 -