Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6K4P Olfactory Receptor

Gene Symbol OR6K4P1 (View this gene in GeneCards)
Family 6
Subfamily K
Pseudogene Yes
CORP pseudogene probability score
Aliases OR1-16, OR1-19, HsOR1.4.14P, ORL3064
External Ids HGNC: 15031   GeneBank: AB065632, BK004530, BK004558, NG_004288   ORDB: ORL3064   
Build #39 labels OR6K4P
Chromosomal location 1:158,724,155-158,725,036 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks Coding for partial protein

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6K3 80.61% 294

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6K4 90% 294
Mouse Or6k4 93% 294
Rat Or6k4 90% 294
Cow OR6K4 90% 294
Orang OR6K4 96% 294
Orang OR6K4B 96% 294
Horse OR6K4 90% 294
Chimp OR6K4 98% 294

Expression evidences

Source Accession
GNF Atlas2 gnf1h10856_at

Sequence information

Nucleotide sequence GTAACAGAGTTTCTCTTCTCTGGATTCCCACAGTTTGAAGATGGTAGCCTCCTCTTCTTC
ATTCCATTGTTTGTTATCTACATATTCATTGTCATTGGGAATCTTATTGTATTTTTTGCA
GTCAGGGTGGATACCCGTCTCCACAACCCCATGTATAATTTTATCAGCATTTTCTCATTT
CTGGAGATCTGGTACACAACTGCCACAATTCCCAAGATGCTCTCCATCCTCATCAGCAGG
CAGAGGACCATCTCCATGGTTGGCTGCCTCTTGCAGATGTACTTCTTCCATTCACTGGGA
AATTCAGAGGGGATTTTGTTGACCACCATGGCCATTGATAGGTACGTTGCCATCTGTAAC
CCTCTCCGCTACCCAACCATCATGACCCCCGGGCTCTGTGTTCAGCTCTCTGTGGGGTCC
TGCATCTTTGGCTTTCTTGTGTTGCTCCCAGAGATTGCATGGATTTCCACACTGCCCTTC
TGTGGACCCAACCAAATCCACCAGATCTTCTGTGATTTTGAACCTGTGCTGCGCTTGGCC
TGTACAGACACGTCCATGATTCTGATTGAGGATGTGATCCATGCTGTGGCCATTGTATTC
TCTGTCCTGATTATTGCCCTTTCTTATATCAGAATCATCACTGTAATCCTGAGGATTCCC
TCTGTTGAAGGCCGCCAGAAGGCCTTTTCTACCTGTGCCGCCCATCTTAGTGTCTTTCTG
ATGTTCTATGGCAGTGTATCCCTCATGTACCTGCGTTTCTCTGCCACTTTCCCACCGATT
TTGGACACAGCTGTTGCACTGATGTTTGCAGTTCTTGCTCCCTTTTTCAACCCTATCATC
TATAGCTTTAGAAATAAGGACATGAAGATTGCAATTAAAAAG
Conceptual translation VTEFLFSGFPQFEDGSLLFFIPLFVIYIFIVIGNLIVFFAVRVDTRLHNPMYNFISIFSF
LEIWYTTATIPKMLSILISRQRTISMVGCLLQMYFFHSLGNSEGILLTTMAIDRYVAICN
PLRYPTIMTPGLCVQLSVGSCIFGFLVLLPEIAWISTLPFCGPNQIHQIFCDFEPVLRLA
CTDTSMILIEDVIHAVAIVFSVLIIALSYIRIITVILRIPSVEGRQKAFSTCAAHLSVFL
MFYGSVSLMYLRFSATFPPILDTAVALMFAVLAPFFNPIIYSFRNKDMKIAIKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 158,693,978 158,693,978 SNP A/G rs16840708 (DbSNP)
1 158,694,108 158,694,108 SNP A/G/T rs387817 (DbSNP)
1 158,694,109 158,694,109 SNP A/G rs10489842 (DbSNP)
1 158,694,208 158,694,208 SNP A/G rs703143 (DbSNP)
1 158,694,444 158,694,444 SNP A/G rs432335 (DbSNP)
1 158,694,563 158,694,563 SNP A/G rs703144 (DbSNP)
1 158,694,730 158,694,730 SNP C/T rs703145 (DbSNP)
1 158,724,188 158,724,188 SNP A/G 1000GP (CEU, CHBJPT)
1 158,724,319 158,724,319 SNP G/A 1000GP (CEU, CHBJPT)
1 158,724,418 158,724,418 SNP G/A 1000GP (CEU, CHBJPT)
1 158,724,654 158,724,654 SNP A/G 1000GP (CEU, CHBJPT)
1 158,724,773 158,724,773 SNP G/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 158,691,945 158,694,926 Deletion #179 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.