Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6M1 Olfactory Receptor

Gene Symbol OR6M11 (View this gene in GeneCards)
Family 6
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR11-271, HsOR11.18.2, ORL3369
External Ids HGNC: 14711   GeneBank: AB065762, AF399606, AY284165-AY284196, BK004493, NM_001005325   ORDB: ORL3369   
Build #39 labels OR6M1
Chromosomal location 11:123,805,411-123,806,349 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6M2P 72.99% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6M1 88% 313
Chimp CONTIG708.106-4290 73% 311
Chimp CONTIG708.102-4695 99% 225
Mouse Or6s1 53% 308
Rat Or6f1b 53% 295
Cow OR6M7 77% 310

Expression evidences

Source Accession
mRNA BC136931
GNF Atlas2 gnf1h02118_at

Sequence information

Nucleotide sequence ATGGGAAACTGGAGCACTGTGACTGAAATCACCCTAATTGCCTTCCCAGCTCTCCTGGAG
ATTCGAATATCTCTCTTCGTGGTTCTTGTGGTAACTTACACATTAACAGCAACAGGAAAC
ATCACCATCATCTCCCTGATATGGATTGATCATCGCCTGCAAACTCCAATGTACTTCTTC
CTCAGTAATTTGTCCTTTCTGGATATCTTATACACCACTGTCATTACCCCAAAGTTGTTG
GCCTGCCTCCTAGGAGAAGAGAAAACCATATCTTTTGCTGGTTGCATGATCCAAACATAT
TTCTACTTCTTTCTGGGGACGGTGGAGTTTATCCTCTTGGCGGTGATGTCCTTTGACCGC
TACATGGCTATCTGCGACCCACTGCACTACACGGTCATCATGAACAGCAGGGCCTGCCTT
CTGCTGGTTCTGGGATGCTGGGTGGGAGCCTTCCTGTCTGTGTTGTTTCCAACCATTGTA
GTGACAAGGCTACCTTACTGTAGGAAAGAAATTAATCATTTCTTCTGTGACATTGCCCCT
CTTCTTCAGGTGGCCTGTATAAATACTCACCTCATTGAGAAGATAAACTTTCTCCTCTCT
GCCCTTGTCATCCTGAGCTCCCTGGCATTCACTACTGGGTCCTACGTGTACATAATTTCT
ACCATCCTGCGTATCCCCTCCACCCAGGGCCGTCAGAAAGCTTTTTCTACCTGTGCTTCT
CACATCACTGTTGTCTCCATTGCCCACGGGAGCAACATCTTTGTGTATGTGAGACCCAAT
CAGAACTCCTCACTGGATTATGACAAGGTGGCCGCTGTCCTCATCACAGTGGTGACCCCT
CTCCTGAACCCTTTTATCTACAGCTTGAGGAATGAGAAGGTACAGGAAGTGTTGAGAGAG
ACAGTGAACAGAATCATGACCTTGATACAAAGGAAAACT
Conceptual translation MGNWSTVTEITLIAFPALLEIRISLFVVLVVTYTLTATGNITIISLIWIDHRLQTPMYFF
LSNLSFLDILYTTVITPKLLACLLGEEKTISFAGCMIQTYFYFFLGTVEFILLAVMSFDR
YMAICDPLHYTVIMNSRACLLLVLGCWVGAFLSVLFPTIVVTRLPYCRKEINHFFCDIAP
LLQVACINTHLIEKINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCAS
HITVVSIAHGSNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE
TVNRIMTLIQRKT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 123,676,231 123,676,231 NS G/T T/K rs4936845 (DbSNP)
11 123,676,413 123,676,413 SYN A/G Y/Y rs7952150 (DbSNP)
11 123,805,680 123,805,680 NS G/A R/C 1000GP (CEU, CHBJPT)
11 123,805,523 123,805,523 NS G/T T/K 1000GP (CEU, CHBJPT)
11 123,805,705 123,805,705 SYN G/A Y/Y 1000GP (CEU, CHBJPT)
11 100 -100 NS G/T T/K 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A Y/Y 1000GP (YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T276K R231H R224H R224C K194N T158I G94D V74L % Freq CORP
1 T R R R K T G V 59.75 0.047
2 K R R R K T G V 22.04 0.047
3 T R R C K T G V 12.44 0.047
4 T R H R K T G V 1.77 0.047
5 T R R R K I G V 1.61 0.047
6 T R R C N T G V 0.77 0.047
7 K H R R K T G V 0.61 0.039
8 T R R R K T D V 0.54 0.047
9 T R R R N T G V 0.15 0.047
10 T R R R K T G L 0.15 0.047
11 K R R C K T G V 0.08 0.047
12 K R R R K I G V 0.08 0.047

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6M1.aApr07-unspliced main_exon 3UTR chr11 123,805,408 123,805,411 -
CDS chr11 123,805,411 123,806,349 -