Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6N1 Olfactory Receptor

Gene Symbol OR6N11 (View this gene in GeneCards)
Family 6
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR1-22, HsOR1.4.17, ORL3019
External Ids HGNC: 15034   GeneBank: AB065631, AF399608, BK004199, NM_001005185   ORDB: ORL3019   
Build #39 labels OR6N1
Chromosomal location 1:158,765,747-158,766,682 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6N2 66.34% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6N1 88% 308
Chimp CONTIG705.47-338 68% 268
Chimp CONTIG*********** 98% 179
Mouse Or6n1 89% 311
Rat Or6n1 88% 312
Cow OR6N1 89% 311

Expression evidences

Source Accession
mRNA BC146847

Sequence information

Nucleotide sequence ATGGACACAGGGAACTGGAGCCAGGTAGCAGAATTCATCATCTTGGGCTTCCCCCATCTC
CAGGGTGTCCAGATTTATCTCTTCCTCTTGTTGCTTCTCATTTACCTCATGACTGTGTTG
GGAAACCTGCTGATATTCCTGGTGGTCTGCCTGGACTCCCGGCTTCACACACCCATGTAC
CACTTTGTCAGCATTCTCTCCTTCTCAGAGCTTGGCTATACAGCTGCCACCATCCCTAAG
ATGCTGGCAAACTTGCTCAGTGAGAAAAAGACCATTTCATTCTCTGGGTGTCTCCTGCAG
ATCTATTTCTTTCACTCCCTTGGAGCGACTGAGTGCTATCTCCTGACAGCTATGGCCTAC
GATAGGTATTTAGCCATCTGCCGGCCCCTCCACTACCCAACCCTCATGACCCCAACACTT
TGTGCAGAGATTGCCATTGGCTGTTGGTTGGGAGGCTTGGCTGGGCCAGTAGTTGAAATT
TCCTTGATTTCACGCCTCCCATTCTGTGGCCCCAATCGCATTCAGCACGTCTTTTGTGAC
TTCCCTCCTGTGCTGAGTTTGGCTTGCACTGATACGTCTATAAATGTCCTAGTAGATTTT
GTTATAAATTCCTGCAAGATCCTAGCCACCTTCCTGCTGATCCTCTGCTCCTATGTGCAG
ATCATCTGCACAGTGCTCAGAATTCCCTCAGCTGCCGGCAAGAGGAAGGCCATCTCCACG
TGTGCCTCCCACTTCACTGTGGTTCTCATCTTCTATGGGAGCATCCTTTCCATGTATGTG
CAGCTGAAGAAGAGCTACTCACTGGACTATGACCAGGCCCTGGCAGTGGTCTACTCAGTG
CTCACACCCTTCCTCAACCCCTTCATCTACAGCTTGCGCAACAAGGAGATCAAGGAGGCT
GTGAGGAGGCAGCTAAAGAGAATTGGGATATTGGCA
Conceptual translation MDTGNWSQVAEFIILGFPHLQGVQIYLFLLLLLIYLMTVLGNLLIFLVVCLDSRLHTPMY
HFVSILSFSELGYTAATIPKMLANLLSEKKTISFSGCLLQIYFFHSLGATECYLLTAMAY
DRYLAICRPLHYPTLMTPTLCAEIAIGCWLGGLAGPVVEISLISRLPFCGPNRIQHVFCD
FPPVLSLACTDTSINVLVDFVINSCKILATFLLILCSYVQIICTVLRIPSAAGKRKAIST
CASHFTVVLIFYGSILSMYVQLKKSYSLDYDQALAVVYSVLTPFLNPFIYSLRNKEIKEA
VRRQLKRIGILA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/T R/H 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A L/L 1000GP (YRI, YRI)
1 158,735,595 158,735,595 NS C/T R/H rs857824 (DbSNP)
1 158,735,691 158,735,691 NS C/T R/Q rs857825 (DbSNP)
1 158,735,740 158,735,740 NS A/G F/L rs857826 (DbSNP)
1 158,735,892 158,735,892 NS A/G I/T rs857827 (DbSNP)
1 158,736,201 158,736,201 NS A/G I/T rs7521578 (DbSNP)
1 158,736,215 158,736,215 SYN A/G L/L rs6666753 (DbSNP)
1 158,736,217 158,736,217 NS A/G F/L rs857828 (DbSNP)
1 158,736,445 158,736,445 NS C/T A/T rs1864346 (DbSNP)
1 158,765,805 158,765,805 NS C/T R/H 1000GP (CEU, CHBJPT)
1 158,765,901 158,765,901 NS T/C Q/R 1000GP (CEU, CHBJPT)
1 158,765,950 158,765,950 NS A/G F/L 1000GP (CEU, CHBJPT)
1 158,766,102 158,766,102 NS A/G I/T 1000GP (CEU, CHBJPT)
1 158,766,115 158,766,115 NS T/G T/P 1000GP (CEU)
1 158,766,425 158,766,425 SYN G/A L/L 1000GP (CEU, CHBJPT)
1 158,766,655 158,766,655 NS C/T A/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 158,733,537 158,736,572 Deletion #180 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R293H Q261R F245L I194T T190P C169Y T91I L86F A10T % Freq CORP
1 H R L T T C T L A 41.09 0.105
2 R Q F I T C T L A 28.88 0.105
3 H R L T T C T L T 26.80 0.105
4 H R L T T C I L A 1.54 0.105
5 H R L T T Y T L A 0.46 0.105
6 H R L T P C T L A 0.38 0.105
7 H R L T T C T F A 0.31 0.105
8 H Q F I T C T L A 0.23 0.105
9 R R L T T C T L T 0.15 0.105
10 R R L T T C T L A 0.08 0.105
11 H Q L T T C T L T 0.08 0.105

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6N1.aApr07-unspliced main_exon 3UTR chr1 158,765,744 158,765,747 -
CDS chr1 158,765,747 158,766,682 -