Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6N2 Olfactory Receptor

Gene Symbol OR6N21 (View this gene in GeneCards)
Family 6
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR1-23, HsOR1.4.18, ORL3005
External Ids HGNC: 15035   GeneBank: AB065630, BK004200, NM_001005278   ORDB: ORL3005   
Build #39 labels OR6N2
Chromosomal location 1:158,776,685-158,777,635 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6N1 66.34% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6N2 88% 316
Chimp CONTIG705.47-338 99% 270
Mouse Or6n2 86% 316
Rat Or6n2 85% 316
Cow OR6N2 87% 313

Sequence information

Nucleotide sequence ATGGATCAATACAACCATTCAAGCCTGGCTGAATTTGTGTTCCTTGGCTTTGCCAGTGTG
GGCTATGTCAGGGGCTGGCTTTTTGTCCTGCTGCTATTGGCATACCTGTTCACCATCTGT
GGTAACATGCTCATCTTCTCAGTCATCCGACTGGATGCAGCTCTGCACACACCTATGTAC
CACTTTGTCAGTGTTCTTTCCTTCTTGGAGTTGTGGTATACAGCTACCACTATCCCTAAG
ATGTTGTCTAATATTCTCAGTGAGAAGAAAACCATTTCTTTTGCAGGATGCCTCCTTCAG
ACCTACTTCTTCCACTCCTTGGGAGCGTCTGAATGCTACCTTCTTACAGCCATGGCCTAT
GATAGATACCTGGCCATTTGTCGGCCCCTCCACTACCCTATAATTATGACCACCACACTC
TGTGCCAAGATGGCTGCTGCTTGTTGGACTTGTGGCTTCCTGTGTCCCATTTCTGAGGTC
ATCCTTGCCTCCCAGCTCCCATTTTGTGCTTACAATGAAATCCAACACATTTTCTGTGAC
TTTCCACCTTTGCTGAGCTTGGCCTGCAAGGACACATCTGCTAACATTCTGGTGGACTTT
GCCATTAATGCTTTCATAATTCTTATCACTTTCTTCTTTATCATGATTTCTTATGCAAGG
ATCATTGGGGCTGTGCTGAAGATAAAAACAGCATCAGGAAGAAAGAAGGCCTTTTCTACC
TGTGCCTCACATCTTGCTGTGGTCCTCATCTTCTTTGGGAGCATCATCTTCATGTATGTG
CGGCTAAAGAAGAGCTATTCCCTGACCCTTGACCGAACACTTGCTATAGTTTACTCCGTA
CTAACACCAATGGTCAATCCAATTATCTACAGTCTTCGTAACAAGGAAATCATTAAAGCT
ATCAAGAGGACCATCTTCCAGAAGGGAGATAAAGCTAGTCTTGCTCATCTT
Conceptual translation MDQYNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMY
HFVSVLSFLELWYTATTIPKMLSNILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAY
DRYLAICRPLHYPIIMTTTLCAKMAAACWTCGFLCPISEVILASQLPFCAYNEIQHIFCD
FPPLLSLACKDTSANILVDFAINAFIILITFFFIMISYARIIGAVLKIKTASGRKKAFST
CASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKA
IKRTIFQKGDKASLAHL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 nonsense SNP G/A R/* 1000GP (YRI)
1 100 -100 NS T/C I/V 1000GP (YRI)
1 100 -100 SYN A/G S/S 1000GP (YRI, YRI, YRI)
1 158,746,678 158,746,678 NS C/T V/I rs41273541 (DbSNP)
1 158,746,815 158,746,815 NS A/G V/A rs12027473 (DbSNP)
1 158,746,847 158,746,847 SYN A/G S/S rs16841094 (DbSNP)
1 158,776,888 158,776,888 NS T/C I/V 1000GP (CEU, CHBJPT)
1 158,777,025 158,777,025 NS G/A A/V 1000GP (CHBJPT)
1 158,777,057 158,777,057 SYN A/G S/S 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 158,744,475 158,747,525 CopyNumber #27 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R272* I250V A204V D199V % Freq CORP
1 R I A D 86.71 0.060
2 R V A D 11.29 0.060
3 R I V D 1.54 0.060
4 * V A D 0.31 1.200
5 R V A V 0.08 0.060
6 * I A D 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6N2.aApr07-unspliced main_exon 3UTR chr1 158,776,682 158,776,685 -
CDS chr1 158,776,685 158,777,635 -