Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6Q1 Olfactory Receptor

Gene Symbol OR6Q11 (View this gene in GeneCards)
Family 6
Subfamily Q
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR11-226, HsOR11.12.3, ORL3427
External Ids HGNC: 15302   GeneBank: AB065737, AF399609, BK004291, NM_001005186   ORDB: ORL3427   
Build #39 labels OR6Q1
Chromosomal location 11:58,030,953-58,031,903 (+)
Cluster 11@58
Synteny CLIC#27
Remarks Segregating Pseudo Gene, a polymorphism of C->del at position 685

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6A2 50% 298
OR6B1 49.5% 303
OR6N1 48.51% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6Q1 89% 317
Chimp CONTIG229.225-27538 97% 317
Mouse Or6ae1 50% 302
Rat Or6ae1 51% 309
Cow OR6Q1 77% 317

Expression evidences

Source Accession
mRNA BC151146
GNF Atlas2 gnf1h10938_at

Sequence information

Nucleotide sequence ATGCAACCATATACCAAAAACTGGACCCAGGTAACTGAATTTGTCATGATGGGCTTTGCT
GGCATCCATGAAGCACACCTCCTCTTCTTCATACTCTTCCTCACCATGTACCTGTTCACC
TTGGTGGAGAATTTGGCCATCATTTTAGTGGTGGGTTTGGACCACCGACTACGGAGACCC
ATGTATTTCTTCCTGACACACTTGTCCTGCCTTGAAATCTGGTACACTTCTGTTACAGTG
CCCAAGATGCTGGCTGGTTTTATTGGGGTGGATGGTGGCAAGAATATCTCTTATGCTGAT
TGCCTATCCCAGCTCTTCATCTTCACCTTTCTTGGGGCAACTGAGTGTTTCCTACTGGCT
GCCATGGCCTATGATCGTTATGTGGCCATTTGTATGCCTCTCCACTATGGGGCTTTTGTG
TCCTGGGGCACCTGCATCCGTCTGGCAGCTGCCTGTTGGCTGGTAGGTTTCCTCACACCC
ATCTTGCCAATCTACCTCTTGTCTCAGCTAACATTTTATGGCCCAAATGTCATTGACCAT
TTCTCCTGTGATGCCTCACCCTTGCTAGCCTTGTCGTGCTCAGATGTCACTTGGAAGGAG
ACTGTGGATTTCCTGGTGTCTCTGGCTGTGCTACTGGCCTCCTCTATGGTCATTGCTGTG
TCCTATGGCAACATCGTCTGGACACTGCTGCACATCCGCTCAGCTGCTGAGCGCTGGAAG
GCCTTCTCTACCTGTGCAGCTCACCTGACTGTGGTGAGCCTCTTCTATGGCACTCTTTTC
TTTATGTATGTCCAGACCAAGGTGACCTCCTCCATCAACTTCAACAAGGTGGTATCTGTC
TTCTACTCTGTTGTCACGCCCATGCTCAATCCTCTCATCTACAGTCTTAGGAACAAGGAA
GTGAAGGGAGCTCTGGGTCGAGTCTTTTCTCTCAACTTTTGGAAGGGACAG
Conceptual translation MQPYTKNWTQVTEFVMMGFAGIHEAHLLFFILFLTMYLFTLVENLAIILVVGLDHRLRRP
MYFFLTHLSCLEIWYTSVTVPKMLAGFIGVDGGKNISYADCLSQLFIFTFLGATECFLLA
AMAYDRYVAICMPLHYGAFVSWGTCIRLAAACWLVGFLTPILPIYLLSQLTFYGPNVIDH
FSCDASPLLALSCSDVTWKETVDFLVSLAVLLASSMVIAVSYGNIVWTLLHIRSAAERWK
AFSTCAAHLTVVSLFYGTLFFMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKE
VKGALGRVFSLNFWKGQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/C K/N 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T S/S 1000GP (YRI)
11 57,798,686 57,798,686 NS A/T I/F rs61741314 (DbSNP)
11 57,798,723 57,798,723 NS A/G D/G rs921135 (DbSNP)
11 57,798,801 57,798,801 NS A/G H/R rs61739978 (DbSNP)
11 57,798,923 57,798,923 NS A/T M/L rs61748337 (DbSNP)
11 57,798,942 57,798,942 NS A/G Y/C rs2513726 (DbSNP)
11 57,799,109 57,799,109 Del(1) -/C rs34846253 (DbSNP)
11 57,799,183 57,799,183 SYN C/T S/S rs7123727 (DbSNP)
11 57,799,371 57,799,371 NS C/G A/G rs1374570 (DbSNP)
11 58,031,031 58,031,031 NS C/T L/F 1000GP (CEU)
11 58,031,251 58,031,251 NS A/G D/G 1000GP (CEU, CHBJPT)
11 58,031,326 58,031,326 NS A/T D/V 1000GP (CHBJPT)
11 58,031,470 58,031,470 NS A/G Y/C 1000GP (CEU, CHBJPT)
11 58,031,711 58,031,711 SYN C/T S/S 1000GP (CEU, CHBJPT)
11 58,031,899 58,031,899 NS G/C G/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 57,798,325 57,801,375 CopyNumber #70 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L27F K82N D100G D125V L167M Y173C A190T G316A % Freq CORP
1 L K D D L Y A A 46.62 0.088
2 L K G D L C A G 36.18 0.088
3 L K D D L Y A G 14.44 0.088
4 L K G V L C A G 1.15 1.000
5 L K G D L C T G 0.38 0.088
6 F K D D L Y A A 0.31 0.088
7 L K G D L Y A G 0.31 0.088
8 L K D D M Y A A 0.23 0.088
9 L N D D L Y A G 0.23 0.088
10 L K G D L C A A 0.08 0.088
11 L K D D L C A G 0.08 0.088

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6Q1.aApr07-unspliced main_exon CDS chr11 58,030,953 58,031,903 +
3UTR chr11 58,031,903 58,031,906 +