Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6R1P Olfactory Receptor

Gene Symbol OR6R1P1 (View this gene in GeneCards)
Family 6
Subfamily R
Pseudogene Yes
CORP pseudogene probability score
Aliases OR1-41, HsOR1.5.13P, ORL3075
External Ids HGNC: 15037   GeneBank: AB065448, BK004588, NG_004270   ORDB: ORL3075   
Build #39 labels OR6R1P
Chromosomal location 1:247,833,360-247,834,288 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6J1 52.49% 301
OR6M1 52.33% 300
OR6T1 49.34% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6M1 53% 301
Mouse Or6b6 47% 309
Rat Or6b6 46% 309
Cow OR6AN1 54% 304
Orang OR6R1BP 89% 310
Horse OR6R14P 66% 312
Chimp OR6R6P 95% 218

Sequence information

Nucleotide sequence ATGGAAAGGGGAAATTGGACATTGGTGACTGAGTTTATTCTTGTGGGGATACCAACCACC
AGAGCCCTTGGGGGCCTCCTCTTTGTGATTTTTTATCAGCCTATTTGGTGACAGTCCTTG
GAAACACCCTTATTATTATCCTGATTCTTGTGGATTACAGGCTCCACTCACCCATGTATT
TCTTCCTCAGCAATCTCTCTTTCAGTGAAACATTAACCATAACCTGTGCTGTTCCTAAGA
TGCTGGAGGGCTTCCCGTCGGAAAGGAAGAGCATCACAAGTGGCGAATGCTCTGCACAGT
CCTATTTCTATTTTCTTTCCGGATGCACTGAGTTTATTCCTTTTGCTGTCATGTCCTATG
ACCGCTATGTGGCCATTTGCAGTCCTCTTCAGTACCCTGCAATTATGACCAGCTCACTCT
GTGCCCACCTCGTCATCCTCTCCTGGGTGGGTGGCTTTCTCCTCATGCTCCCATCCACCA
TCCTCAAGGCAGGACTGCCACACTGTGGTCCCAACGTGATTGAGCACTTTTTCTGTGACA
GCGCCCCTCTCCTCCACCTGGCCTGTGCTGACATTCGTGCTATTGAGCTGTTGGACTTTC
TCAGCTCACTGGTCCTGATCCTCAGCTCCCTCTCACTCACAGTGGTCTCCTATGTTTACA
TCATCTCCACCATTCTGAAGATACCCTCAGGCCAAGGTCAACGCAAAGCCTTTGCCACCT
GTGCCTCTCACTTCACGGTGGTCTCCGTGGGCTATGGGATCTCCATCTTTGTCTATGTTC
ACCCCTCACAGAAGAGCAGCCTGCACCTCAACAAGATCCTCTTTATCCTCTCCAGCATCA
TCACACCCCTCCTGAATCCCTTCGTCTTCAGTCTGTGGAATGAACCCATGAAAGATGCAC
TGAAGGACGCCTCGGCCGGAGGACAGAGC
Conceptual translation MERGNWTLVTEFILVGIPTTRALGGLLFVI/LSAYLVTVLGNTLIIILILVDYRLHSPM
YFFLSNLSFSETLTITCAVPKMLEGFPSERKSITSGECSAQSYFYFLSGCTEFIPFAVMS
YDRYVAICSPLQYPAIMTSSLCAHLVILSWVGGFLLMLPSTILKAGLPHCGPNVIEHFFC
DSAPLLHLACADIRAIELLDFLSSLVLILSSLSLTVVSYVYIISTILKIPSGQGQRKAFA
TCASHFTVVSVGYGISIFVYVHPSQKSSLHLNKILFILSSIITPLLNPFVFSLWNEPMKD
ALKDASAGGQS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 247,833,371 247,833,371 SNP C/T 1000GP (CEU, CHBJPT)
1 247,833,376 247,833,376 SNP G/A 1000GP (CEU, CHBJPT)
1 247,833,404 247,833,404 SNP G/C 1000GP (CEU, CHBJPT)
1 247,833,413 247,833,413 SNP A/G 1000GP (CEU, CHBJPT)
1 247,833,587 247,833,587 SNP G/A 1000GP (CEU, CHBJPT)
1 247,833,588 247,833,588 SNP T/C 1000GP (CEU, CHBJPT)
1 247,833,650 247,833,650 SNP T/A 1000GP (CEU)
1 247,833,656 247,833,656 SNP A/G 1000GP (CEU)
1 247,833,671 247,833,671 SNP T/G 1000GP (CEU, CHBJPT)
1 247,833,812 247,833,812 SNP T/A 1000GP (CEU, CHBJPT)
1 247,996,667 247,996,667 SNP A/G rs61856532 (DbSNP)
1 247,996,673 247,996,673 SNP C/T rs4925730 (DbSNP)
1 247,996,678 247,996,678 SNP A/G rs74152831 (DbSNP)
1 247,996,706 247,996,706 SNP C/G rs74152832 (DbSNP)
1 247,996,715 247,996,715 SNP A/G rs74152833 (DbSNP)
1 247,996,855 247,996,855 SNP A/G rs74152834 (DbSNP)
1 247,996,889 247,996,889 In-Del(1) T/GT rs4925731 (DbSNP)
1 247,996,889 247,996,889 SNP A/G rs74152835 (DbSNP)
1 247,996,890 247,996,890 SNP C/T rs4925732 (DbSNP)
1 247,996,939 247,996,939 SNP G/T rs74152836 (DbSNP)
1 247,996,951 247,996,954 Del(4) -/GTGA rs35033596 (DbSNP)
1 247,996,956 247,996,959 Del(4) -/TGAG rs74163813 (DbSNP)
1 247,996,973 247,996,973 SNP G/T rs4925733 (DbSNP)
1 247,997,114 247,997,114 SNP A/T rs10788726 (DbSNP)
1 247,997,271 247,997,271 SNP A/G rs61613675 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.