Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6T1 Olfactory Receptor

Gene Symbol OR6T11 (View this gene in GeneCards)
Family 6
Subfamily T
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-277, HsOR11.18.7, ORL3378
External Ids HGNC: 14848   GeneBank: AB065759, BK004315, NM_001005187   ORDB: ORL3378   
Build #39 labels OR6T1
Chromosomal location 11:123,942,870-123,943,838 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6E1P 50.67% 300
OR6J1 50.16% 315
OR6M1 52.49% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6T1P 85% 307
Chimp CONTIG708.114-18022 96% 323
Mouse Or6c66b 51% 299
Rat Or6c75-ps 50% 299
Cow OR6T8P 68% 298

Expression evidences

Source Accession
mRNA BC136906
GNF Atlas2 gnf1h05560_at

Sequence information

Nucleotide sequence ATGAACCCTGAAAACTGGACTCAGGTAACAAGCTTTGTCCTTCTGGGTTTCCCCAGTAGC
CACCTCATACAGTTCCTGGTGTTCCTGGGGTTAATGGTGACCTACATTGTAACAGCCACA
GGCAAGCTGCTAATTATTGTGCTCAGCTGGATAGACCAACGCCTGCACATACAGATGTAC
TTCTTCCTGCGGAATTTCTCCTTCCTGGAGCTGTTGCTGGTAACTGTTGTGGTTCCCAAG
ATGCTTGTCGTCATCCTCACGGGGGATCACACCATCTCATTTGTCAGCTGCATCATCCAG
TCCTACCTCTACTTCTTTCTAGGCACCACTGACTTCTTCCTCTTGGCCGTCATGTCTCTG
GATCGTTACCTGGCAATCTGCCGACCACTCCGCTATGAGACCCTGATGAATGGCCATGTC
TGTTCCCAACTAGTGCTGGCCTCCTGGCTAGCTGGATTCCTCTGGGTCCTTTGCCCCACT
GTCCTCATGGCCAGCCTGCCTTTCTGTGGCCCCAATGGTATTGACCACTTCTTTCGTGAC
AGTTGGCCCTTGCTCAGGCTTTCTTGTGGGGACACCCACCTGCTGAAACTGGTGGCTTTC
ATGCTCTCTACGTTGGTGTTACTGGGCTCACTGGCTCTGACCTCAGTTTCCTATGCCTGC
ATTCTTGCCACTGTTCTCAGGGCCCCTACAGCTGCTGAGCGAAGGAAAGCGTTTTCCACT
TGCGCCTCGCATCTTACAGTGGTGGTCATCATCTATGGCAGTTCCATCTTTCTCTACATT
CGTATGTCAGAGGCTCAGTCCAAACTGCTCAACAAAGGTGCCTCCGTCCTGAGCTGCATC
ATCACACCCCTCTTGAACCCATTCATCTTCACTCTCCGCAATGACAAGGTGCAGCAAGCA
CTGAGAGAAGCCTTGGGGTGGCCCAGGCTCACTGCTGTGATGAAACTGAGGGTCACAAGT
CAAAGGAAA
Conceptual translation MNPENWTQVTSFVLLGFPSSHLIQFLVFLGLMVTYIVTATGKLLIIVLSWIDQRLHIQMY
FFLRNFSFLELLLVTVVVPKMLVVILTGDHTISFVSCIIQSYLYFFLGTTDFFLLAVMSL
DRYLAICRPLRYETLMNGHVCSQLVLASWLAGFLWVLCPTVLMASLPFCGPNGIDHFFRD
SWPLLRLSCGDTHLLKLVAFMLSTLVLLGSLALTSVSYACILATVLRAPTAAERRKAFST
CASHLTVVVIIYGSSIFLYIRMSEAQSKLLNKGASVLSCIITPLLNPFIFTLRNDKVQQA
LREALGWPRLTAVMKLRVTSQRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A R/W 1000GP (YRI, YRI)
11 100 -100 SYN C/T A/A 1000GP (YRI, YRI, YRI, YRI)
11 123,813,795 123,813,795 NS C/T V/I rs7937317 (DbSNP)
11 123,813,823 123,813,823 SYN A/G C/C rs7129884 (DbSNP)
11 123,813,915 123,813,915 SYN A/G L/L rs12274518 (DbSNP)
11 123,813,940 123,813,940 SYN C/G L/L rs7130003 (DbSNP)
11 123,814,261 123,814,261 SYN A/G V/V rs6590020 (DbSNP)
11 123,814,356 123,814,356 NS A/G W/R rs6590021 (DbSNP)
11 123,814,478 123,814,478 NS A/G I/T rs6590022 (DbSNP)
11 123,814,489 123,814,489 SYN A/G S/S rs4936859 (DbSNP)
11 123,943,088 123,943,088 NS T/C I/V 1000GP (CHBJPT)
11 123,943,116 123,943,116 SYN G/A C/C 1000GP (CEU, CHBJPT)
11 123,943,233 123,943,233 SYN G/C L/L 1000GP (CEU, CHBJPT)
11 123,943,554 123,943,554 SYN G/A V/V 1000GP (CHBJPT)
11 123,943,649 123,943,649 NS G/A R/W 1000GP (CHBJPT)
11 123,943,771 123,943,771 NS A/G I/T 1000GP (CHBJPT)
11 123,943,782 123,943,782 SYN A/G S/S 1000GP (CEU, CHBJPT)
11 123,943,799 123,943,799 NS G/A L/F 1000GP (CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V276I I251V S243L A228D N137T R64W I23T L14F % Freq CORP
1 V I S A N R I L 91.78 1.000
2 V V S A N W T L 6.14 1.000
3 V I L A N R I L 0.54 1.000
4 I I S A N R I L 0.38 1.000
5 V V S A N W I L 0.38 1.000
6 V I S D N R I L 0.31 1.000
7 V I S A T R I L 0.23 1.000
8 V I S A N W T L 0.08 1.000
9 V I S A N R I F 0.08 1.000
10 V I S A N W I L 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6T1.aApr07-unspliced main_exon 3UTR chr11 123,942,867 123,942,870 -
CDS chr11 123,942,870 123,943,838 -