Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6U2P Olfactory Receptor

Gene Symbol OR6U2P1 (View this gene in GeneCards)
Family 6
Subfamily U
Pseudogene Yes
CORP pseudogene probability score
Aliases OR12-8, HsOR12.5.25P
External Ids HGNC: 19631   GeneBank: AB065556, BK004557, NG_004348   
Build #39 labels OR6U2P, OR6U1P
Chromosomal location 12:55,611,623-55,612,554 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AP1 56.86% 306
OR6C4 54.9% 306
OR6C76 55.37% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C45P 59% 306
Mouse Or6c63-ps 58% 310
Rat Or6c63 57% 308
Cow OR6C63 58% 307
Orang OR6C76P 54% 306
Horse OR6U2 85% 311
Chimp OR6U2 96% 311

Sequence information

Nucleotide sequence ATGGCCAATCAGACTGTGGTGACTGAGTTCTTCCTCCAAGGCCTGACGGATACCAAAGAG
CTTCAGGTGGCTGTTTTTCTGCTCCTGCTGCTTGCCTACCTTGTGACTGTCTCTGGGAAC
CTGATCATCATCAGCCTGACCTTGCTGGACACCCGCCTGCAGACATCTATGTACTTATTT
CTCCAGAATCTGTCCTGCTTAGAAATTTGGTTCCAGACAGTCATCGTGCCCAAGATGCTG
CTCAACATTGCCATGGGGACCAAGACCGTTAGCTTTGCTGGGTGCATTACCCAGGACTTT
TTCCACATCTTCTGGGGGCCACAGAGTTCTTCCTCCTCACAGCCATGGCCTATGACCAGT
ATATTGCCATCTGCAAGCCCCTCCACTACCCCATGCTCATAAGTAGTAGAGTCTGCACAC
AGCTCATCCTCACCTGCTGGCTACTAGGTTTCTCCTTCATCATCATGCCTGTCATCCTGA
CCAGTCAGCTTCCATTCTGTGATACCCACATCAAGCATTTCTTCTGTGACTACACGCCTC
TAATGGAGGTGGTCTGCAGTGGGCCAAAGGTGCTGGAGATGGTGGATTTTACCCTGGCCT
TAGTAGCACTGTTTGGCACCTTGGTACTCATCACCCTGTCCTATGTCCAGATCATCCAGA
CAATTGTCAGAATCCCCGCTGTCCAGGAGAGGAAGAAGGCTTTCTCTACCTGTTCCTCTC
ATGTCATTATGGTTACCATGTGTTATGACAGCTGCTTCTTTATGTATGTCAAGCCCTCTC
CAGGAAAGTGGGTTGATGTCAACAAGGGAGTGTCTCTAATCAATACAATTATTGCCCCAC
TGTTAAATCCCTTCATCTGTACTCTGAGGAACCAACAAGTTAAGCAGGTAATGAAAGACC
TAGTCAGAAAAATGACTTTGTTCCAAAATAAA
Conceptual translation MANQTVVTEFFLQGLTDTKELQVAVFLLLLLAYLVTVSGNLIIISLTLLDTRLQTSMYLF
LQNLSCLEIWFQTVIVPKMLLNIAMGTKTVSFAGCITQDFFHI/LGATEFFLLTAMAYD
QYIAICKPLHYPMLISSRVCTQLILTCWLLGFSFIIMPVILTSQLPFCDTHIKHFFCDYT
PLMEVVCSGPKVLEMVDFTLALVALFGTLVLITLSYVQIIQTIVRIPAVQERKKAFSTCS
SHVIMVTMCYDSCFFMYVKPSPGKWVDVNKGVSLINTIIAPLLNPFICTLRNQQVKQVMK
DLVRKMTLFQNK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI)
12 55,611,848 55,611,848 SNP G/A 1000GP (CEU)
12 55,611,945 55,611,945 SNP A/G 1000GP (CEU)
12 56,005,409 56,005,409 SNP A/G rs55853765 (DbSNP)
12 56,005,632 56,005,632 SNP A/G rs55761398 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 109 (Hasin)
12 56,005,307 56,008,338 CopyNumber #129 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.