Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6X1 Olfactory Receptor

Gene Symbol OR6X11 (View this gene in GeneCards)
Family 6
Subfamily X
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-270, HsOR11.18.1, ORL3438
External Ids HGNC: 14737   GeneBank: AB065510, BK004362, NM_001005188   ORDB: ORL3438   
Build #39 labels OR6X1
Chromosomal location 11:123,753,583-123,754,518 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6F1 48.83% 299
OR6M1 48.18% 303
OR6M2P 48.36% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6X1 86% 312
Chimp CONTIG*********** 97% 312
Mouse Or6x1 85% 312
Rat Or6x1 84% 312
Cow OR6M2 52% 304

Expression evidences

Source Accession
mRNA BC136856
GNF Atlas2 gnf1h02119_at

Sequence information

Nucleotide sequence ATGAGAAATGGCACAGTAATCACAGAATTCATCCTGCTAGGCTTTCCTGTTATCCAAGGC
CTACAAACACCTCTCTTTATTGCAATCTTTCTCACCTACATATTAACCCTTGCAGGCAAT
GGGCTTATTATTGCCACTGTGTGGGCTGAGCCCAGGCTACAAATTCCAATGTACTTCTTC
CTTTGTAACTTGTCTTTCTTAGAAATCTGGTACACCACCACAGTCATCCCCAAACTGCTA
GGAACCTTTGTAGTGGCAAGAACAGTAATCTGCATGTCCTGCTGCCTGCTGCAGGCCTTC
TTCCACTTCTTCGTGGGCACCACCGAGTTCTTGATCCTCACTATCATGTCTTTTGACCGC
TACCTCACCATCTGCAATCCCCTTCACCACCCCACCATCATGACCAGCAAACTCTGCCTG
CAGCTGGCCCTGAGCTCCTGGGTGGTGGGCTTCACCATTGTCTTTTGTCAGACGATGCTG
CTCATCCAGTTGCCATTCTGTGGCAATAATGTTATCAGTCATTTCTACTGTGATGTTGGG
CCCAGTTTGAAAGCCGCCTGCATAGACACCAGCATTTTGGAACTCCTGGGCGTCATAGCA
ACCATCCTTGTGATCCCAGGGTCACTTCTCTTTAATATGATTTCTTATATCTACATTCTG
TCCGCAATCCTACGAATTCCTTCAGCCACTGGCCACCAAAAGACTTTCTCTACCTGTGCC
TCGCACCTGACAGTTGTCTCCCTGCTCTACGGGGCTGTTCTGTTCATGTACCTAAGACCC
ACAGCACACTCCTCCTTTAAGATTAATAAGGTGGTGTCTGTGCTAAATACTATCCTCACC
CCCCTTCTGAATCCCTTTATTTATACTATTAGAAACAAGGAGGTGAAGGGAGCCTTAAGA
AAGGCAATGACTTGCCCAAAGACTGGTCATGCAAAG
Conceptual translation MRNGTVITEFILLGFPVIQGLQTPLFIAIFLTYILTLAGNGLIIATVWAEPRLQIPMYFF
LCNLSFLEIWYTTTVIPKLLGTFVVARTVICMSCCLLQAFFHFFVGTTEFLILTIMSFDR
YLTICNPLHHPTIMTSKLCLQLALSSWVVGFTIVFCQTMLLIQLPFCGNNVISHFYCDVG
PSLKAACIDTSILELLGVIATILVIPGSLLFNMISYIYILSAILRIPSATGHQKTFSTCA
SHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKGALR
KAMTCPKTGHAK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 123,624,658 123,624,658 NS G/T T/N rs12364099 (DbSNP)
11 123,753,950 123,753,950 NS G/T T/N 1000GP (CEU, CHBJPT)
11 100 -100 SYN G/C P/P 1000GP (YRI, YRI)
11 100 -100 NS T/C I/V 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 59 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I268V A229G T190N A185V R120C T74I % Freq CORP
1 I A T A R T 88.94 1.000
2 I A N A R T 8.53 1.000
3 V A T A R T 1.46 1.000
4 I G T A R I 0.46 1.000
5 I A T V R T 0.38 1.000
6 I A T A C T 0.23 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6X1.aApr07-unspliced main_exon 3UTR chr11 123,753,580 123,753,583 -
CDS chr11 123,753,583 123,754,518 -