Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7A17 Olfactory Receptor

Gene Symbol OR7A171 (View this gene in GeneCards)
Family 7
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR19-20, HSHTPCRX19, HsOR19.3.6, ORL1028
External Ids HGNC: 8363   GeneBank: AF399541, BK004206, HSHTPRX19, NM_030901   ORDB: ORL1028   
Build #39 labels OR7A17
Chromosomal location 19:14,880,429-14,881,355 (-)
Cluster 19@15a
Synteny CLIC#45
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7A10 82.52% 309
OR7A1P 80.39% 306
OR7A2P 80.66% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7A60 79% 302
Dog OR7A17 80% 302
Chimp CONTIG1211.24-5657 82% 309
Chimp CONTIG1211.27-12914 82% 305
Chimp CONTIG1211.27-1153 81% 309
Mouse Or7a40 76% 308
Rat Or7a41 77% 304
Cow OR7A65 80% 308

Expression evidences

Source Accession
ESTs AI909504
mRNA X64993
GNF Atlas2 208509_s_at

Sequence information

Nucleotide sequence ATGGAACCAGAGAATGACACAGGGATTTCAGAATTTGTTCTTCTGGGACTTTCTGAGGAA
CCAGAATTGCAGCCCTTCCTCTTTGGGCTGTTTCTGTCCATGTACCTGGTCACTGTGCTC
GGGAATCTGCTCATCATCCTGGCCACAATCTCAGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCCTTTGCAGACATCTGTTTCATCTCCACTACAATCCCAAAG
ATGCTCATTAACATCCAGACACAGAGCAGAGTCATCACCTATGCAGGCTGCATCACCCAG
ATGTGCTTTTTTGTACTTTTTGGAGGGTTAGACAGCTTACTCCTGGCTGTGATGGCCTAT
GATCGGTTTGTGGCCATCTGTCATCCTCTGCACTACACAGTCATCATGAACCCTCGGCTC
TGTGGACTCCTGGTTCTGGCATCCTGGATGATTGCTGCCCTGAATTCCTTGTCACAAAGC
TTAATGGTATTGTGGCTGTCCTTCTGCACAGACTTGGAAATCCCCCACTTTTTCTGTGAA
CTTAATCAGGTCATCCACCTTGCCTGTTCTGACACCTTTCTTAATGACATGGGGATGTAT
TTTGCAGCAGGGCTGCTGGCTGGTGGTCCCCTTGTGGGGATCCTTTGCTCTTACTCTAAG
ATAGTTTCCTCCATACGTGCAATCTCATCAGCTCAGGGGAAGTACAAGGCATTTTCCACC
TGTGCATCACACCTCTCAGTTGTCTCTTTATTTTGTTGTACGGGCCTAGGTGTGTACCTT
ACTTCTGCTGCAACCCACAACTCACACACAAGTGCAACAGCCTCAGTGATGTACACTGTG
GCCACCCCCATGCTGAACCCCTTTATCTACAGTCTGAGGAATAAAGACATAAAGAGGGCT
CTGAAAATGTCCTTCAGAGGAAAGCAA
Conceptual translation MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAY
DRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCE
LNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFST
CASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRA
LKMSFRGKQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS G/T S/R 1000GP (YRI, YRI)
19 100 -100 SYN T/G S/S 1000GP (YRI, YRI, YRI)
19 14,880,831 14,880,831 SYN G/A P/P 1000GP (CEU, CHBJPT)
19 14,881,219 14,881,219 NS A/G I/T 1000GP (CEU)
19 14,881,230 14,881,230 SYN A/G N/N 1000GP (CEU, CHBJPT)
19 14,881,233 14,881,233 SYN C/T G/G 1000GP (CEU, CHBJPT)
19 14,991,399 14,991,399 NS C/T G/S rs12461347 (DbSNP)
19 14,991,439 14,991,439 SYN G/T S/S rs34590588 (DbSNP)
19 14,991,459 14,991,459 NS C/T A/T rs13345394 (DbSNP)
19 14,991,529 14,991,529 Del(1) -/C rs5827261 (DbSNP)
19 14,991,635 14,991,635 Del(1) -/A rs35659165 (DbSNP)
19 14,991,643 14,991,643 SYN A/G P/P rs10401818 (DbSNP)
19 14,991,792 14,991,792 Del(1) -/T rs34777619 (DbSNP)
19 14,991,963 14,991,963 NS A/C S/A rs10404119 (DbSNP)
19 14,992,031 14,992,031 NS A/G I/T rs10405129 (DbSNP)
19 14,992,042 14,992,042 SYN A/G N/N rs10405136 (DbSNP)
19 14,992,045 14,992,045 SYN C/T G/G rs10404335 (DbSNP)
19 14,992,058 14,992,058 NS A/G V/A rs10405148 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A237T R226H S112R G96D Y94C N84D A69S I46T V37A % Freq CORP
1 A R S G Y N A I V 61.37 0.022
2 A R S G Y N S T V 29.95 0.022
3 T R S G Y N A I V 3.00 0.061
4 A R S G Y N S I V 2.53 0.022
5 A R S G Y N A I A 1.23 0.022
6 A R S D Y N A I V 0.54 0.022
7 T R S G Y N S T V 0.31 0.061
8 A H R G Y N A I V 0.31 0.022
9 A R S G Y N A T V 0.23 0.022
10 A H S G Y N A I V 0.15 0.022
11 A R S G C N S T V 0.08 0.022
12 A R S G C N A I V 0.08 0.022
13 T R S G Y D S T V 0.08 0.061
14 A R S G Y D A I V 0.08 0.022
15 A R S D Y N S T V 0.08 0.022

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7A17.aApr07-unspliced main_exon 3UTR chr19 14,880,326 14,880,429 -
CDS chr19 14,880,429 14,881,355 -
5UTR chr19 14,881,355 14,881,452 -