Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7A1P Olfactory Receptor

Gene Symbol OR7A1P1 (View this gene in GeneCards)
Family 7
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR19-3, OLF4p, OR19-21, hg513, HsOR19.3.7P, ORL3788
External Ids HGNC: 8364   GeneBank: AB065576, AF399433, BK004726, NG_004361   ORDB: ORL3788   
Build #39 labels OR7A1P
Chromosomal location 19:14,891,859-14,892,804 (-)
Cluster 19@15a
Synteny CLIC#45
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7A10 78.1% 306
OR7A17 80.39% 306
OR7A2P 78.43% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7A62 75% 304
Mouse Or7a40 72% 308
Rat Or7a41 71% 303
Cow OR7A96 74% 311
Orang OR7A1CP 94% 303
Orang OR7A1BP 92% 308
Horse OR7A96 78% 311
Chimp OR7A1 97% 309

Sequence information

Nucleotide sequence ATGAAACCAGGGAATGAGACACAAATTTCACAATTCCTTCTCCTGGGACTTTCAGAGGAA
CCAGAATTGCAGCCCTTCCTCTTTGGGCTATTTCTGTCCATGTACCTGGTCACCGTGCTC
GGGAACCTGCTCATCATCCTGGCCACAATCTCAGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCCTTTGCAGACATCTGTTTTGTGTCTACCACTGTCCCAAAG
ATGCTGGTGAACATCCAGACACAGAGCAGAGTCATCACCTATGCAGACTGCATCACCCAG
ATGTGCTTTTTTATACTCTTTGTAGTGTTGGACAGCTTACTCCTGACTGTGATGGCCTAT
GACCGGTTTGTGGCCATCTGTCACCCCCTGCACTACACAGTCATTATGAACTCCTGGCTC
TGTGGACTGCTGGTTCTGGTGTCCTGGATCGTGAGCATCCTATATTCTCTGTTACAAAGC
ATAATGGCATTGCAGCTGTCCTTCTGTACAGAATTGAAAATCCCTCATTTTTTCTGTGAA
CTTAATCAGGTCATCCACCTTGCCTGTTCCGACACTTTTATTAATGACATGATGATGAAT
TTTACAAGTGTGCTGCTGGGTGGGGGATGCCTCGCTGGAATATTTTACTTACTTTAAGAT
ACTTTGTTGCATATGTTCGATCTCATCAGCTCAGGGGATGAATAAAGCACTTTCCACCTG
TGCATCTCACCTCTCAGTTGTCTCCTTATTTTATTGTACAGGCGTAGGTGTGTACCTTAG
TTCTGCTGCAACCCATAACTCACTCTCAAATGCTGCAGCCTCGGTGATGTACACTGTGGT
CACCTCCATGCTGAACCCCTTCATCTACAGCCTGAGGAATAAAGACATAAACAGAGCTCT
GAATCGATTCTTCAGAGAGCAGAAACAGGAGGGCCATTTTCCAGAA
Conceptual translation MKPGNETQISQFLLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFADICFVSTTVPKMLVNIQTQSRVITYADCITQMCFFILFVVLDSLLLTVMAY
DRFVAICHPLHYTVIMNSWLCGLLVLVSWIVSILYSLLQSIMALQLSFCTELKIPHFFCE
LNQVIHLACSDTFINDMMMNFTSVLLGGGCLAGI//TYFKILCCICSISSAQGMNKAL
STCASHLSVVSLFYCTGVGVYLSSAATHNSLSNAAASVMYTVVTSMLNPFIYSLRNKDIN
RALNRFFREQKQEGHFPE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 15,002,684 15,002,683 Ins(1) -/C rs34284698 (DbSNP)
19 15,003,164 15,003,164 SNP C/G rs61734249 (DbSNP)
19 15,002,853 15,002,853 SNP C/T rs10419928 (DbSNP)
19 15,003,406 15,003,406 SNP C/T rs12459463 (DbSNP)
19 15,003,562 15,003,562 SNP C/T rs61995695 (DbSNP)
19 15,002,677 15,002,677 SNP G/A rs61751907 (DbSNP)
19 15,003,137 15,003,137 SNP G/A rs61734241 (DbSNP)
19 15,002,827 15,002,827 SNP G/T rs7260124 (DbSNP)
19 15,002,775 15,002,775 SNP T/C rs61747527 (DbSNP)
19 15,002,720 15,002,720 SNP T/G rs61747490 (DbSNP)
19 15,002,842 15,002,842 SNP T/G rs61749303 (DbSNP)
19 14,892,030 14,892,030 SNP G/T 1000GP (CEU, CHBJPT)
19 14,892,325 14,892,325 SNP G/A 1000GP (CEU, CHBJPT)
19 14,892,352 14,892,352 SNP C/G 1000GP (CEU, CHBJPT)
19 14,892,594 14,892,594 SNP T/C 1000GP (CEU, CHBJPT)
19 14,892,750 14,892,750 SNP C/T 1000GP (CEU, CHBJPT)
19 14,891,963 14,891,963 SNP T/C 1000GP (CHBJPT)
19 14,892,015 14,892,015 SNP T/G 1000GP (CHBJPT)
19 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.