Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7A5 Olfactory Receptor

Gene Symbol OR7A51 (View this gene in GeneCards)
Family 7
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases HTPCR2, OR19-17, HsOR19.3.2, ORL214, ORL230
External Ids HGNC: 8368   GeneBank: AF399543, BK004221, HSHTPRH04, HSTPCR92P   ORDB: ORL214, ORL230   
Build #39 labels OR7A5
Chromosomal location 19:14,827,285-14,828,241 (-)
Cluster 19@15a
Synteny CLIC#45
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7A10 81.4% 301
OR7A17 81.73% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7A56 79% 301
Dog OR7A52 80% 303
Chimp CONTIG1211.21-7488 99% 319
Mouse Or7a40 76% 301
Rat Or7a41 72% 320
Cow OR7A65 76% 310
Cow OR7A10B 81% 301

Expression evidences

Source Accession
ESTs BP370465
mRNA X64976
GNF Atlas2 208285_at

Sequence information

Nucleotide sequence ATGGAACCAGGAAATGATACACAAATTTCAGAATTTCTTCTTCTGGGATTTTCACAAGAA
CCTGGACTGCAACCCTTCCTCTTTGGGCTGTTCCTGTCCATGTACCTGGTCACTGTGCTC
GGGAACCTGCTCATCATCCTGGCCACAATCTCAGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCCTTTGCTGACATTTGTGTTACTTCCACCACCATTCCAAAA
ATGCTGATGAACATCCAGACACAGAACAAAGTCATCACCTACATAGCCTGCCTCATGCAG
ATGTATTTTTTCATACTCTTTGCTGGATTTGAAAACTTCCTCCTGTCCGTGATGGCCTAT
GACCGGTTTGTGGCCATCTGTCACCCCCTGCACTACATGGTCATTATGAACCCTCACCTC
TGTGGACTGCTGGTTCTAGCATCCTGGACCATGAGTGCTCTGTATTCCTTGCTACAAATC
TTAATGGTAGTACGGCTGTCCTTCTGCACAGCCTTAGAAATCCCCCACTTTTTCTGTGAA
CTTAATCAGGTCATCCAACTTGCTTGTTCTGATAGCTTTCTTAATCACATGGTGATATAT
TTTACAGTTGCGCTGCTGGGTGGAGGTCCCCTGACTGGGATCCTTTACTCTTACTCTAAG
ATAATTTCTTCCATACATGCAATCTCATCAGCTCAGGGGAAGTACAAGGCATTTTCCACC
TGTGCATCTCACCTCTCAGTTGTCTCCTTATTTTATGGTGCAATCCTAGGGGTGTACCTT
AGTTCTGCTGCCACCCGCAACTCACACTCAAGTGCAACAGCCTCAGTGATGTACACTGTG
GTCACCCCCATGCTGAACCCCTTTATCTATAGTCTGAGGAATAAAGACATAAAGAGGGCT
CTGGGAATACATTTGTTGTGGGGAACAATGAAAGGGCAATTTTTCAAGAAGTGCCCA
Conceptual translation MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFADICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAY
DRFVAICHPLHYMVIMNPHLCGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCE
LNQVIQLACSDSFLNHMVIYFTVALLGGGPLTGILYSYSKIISSIHAISSAQGKYKAFST
CASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRA
LGIHLLWGTMKGQFFKKCP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS T/A H/L 1000GP (YRI, YRI, YRI)
19 100 -100 SYN T/C L/L 1000GP (YRI)
19 14,827,804 14,827,804 SYN T/C L/L 1000GP (CEU, CHBJPT)
19 14,938,190 14,938,190 SYN A/G F/F rs2240561 (DbSNP)
19 14,938,278 14,938,278 NS T/C Y/C rs61731997 (DbSNP)
19 14,938,300 14,938,300 NS A/T Y/N rs62122651 (DbSNP)
19 14,938,412 14,938,412 NS C/G M/I rs61731998 (DbSNP)
19 14,938,421 14,938,421 SYN C/G L/L rs62122652 (DbSNP)
19 14,938,537 14,938,537 NS C/T E/K rs56284724 (DbSNP)
19 14,938,616 14,938,616 SYN C/T L/L rs2190686 (DbSNP)
19 14,938,860 14,938,860 NS T/C N/S rs61731995 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 14,936,097 14,939,153 CopyNumber #130 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A300V T282S I214M A204V E173K R122W G41R % Freq CORP
1 A T I A E R G 95.39 0.078
2 A T I A K R G 2.38 0.078
3 A T M A E R G 0.84 0.078
4 V T I A E R G 0.69 0.078
5 A T I A E R R 0.31 0.078
6 A T I A E W G 0.15 0.602
7 A S I A E R G 0.08 0.078
8 A T I V E R G 0.08 0.078
9 V T M A E R G 0.08 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7A5andOR7C1.bApr07-unspliced main_exon 3UTR chr19 14,826,327 14,827,285 -
CDS chr19 14,827,285 14,828,241 -
5UTR chr19 14,828,241 14,828,464 -
OR7A5andOR7C1.cApr07 main_exon CDS_partial chr19 14,827,764 14,828,241 -
5UTR chr19 14,828,241 14,828,254 -
exon_5UTR chr19 14,835,074 14,835,148 -