Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7C1 Olfactory Receptor

Gene Symbol OR7C11 (View this gene in GeneCards)
Family 7
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR19-16, CIT-HSP-146e8, TPCR86, OR19-5, HsOR19.3.1, ORL3767
External Ids HGNC: 8373   GeneBank: AF399546, BK004220, HSTPCR86P, NM_198944   ORDB: ORL3767   
Build #39 labels OR7C1
Chromosomal location 19:14,799,177-14,800,136 (-)
Cluster 19@15a
Synteny CLIC#45
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7C2 77.81% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7C1 81% 305
Dog OR7C1B 81% 305
Chimp CONTIG1211.18-21851 97% 320
Mouse Or7c19 70% 305
Rat Or7c70 70% 318
Cow OR7C2 74% 320

Expression evidences

Source Accession
ESTs DB338053
mRNA X89676
GNF Atlas2 216690_at

Sequence information

Nucleotide sequence ATGGAAACAGGAAATCAAACACATGCCCAAGAATTTCTCCTCCTGGGATTTTCAGCAACG
TCAGAGATTCAGTTCATTCTCTTTGGGCTGTTCCTCTCCATGTACCTAGTCACTTTCACC
GGGAACCTGCTCATCATCCTGGCCATATGCTCAGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCTTTTGCTGACCTCTGTTTTACCTCCACGACTGTCCCAAAG
ATGTTACTGAATATACTGACACAGAACAAATTCATAACATATGCAGGCTGTCTCAGTCAG
ATTTTTTTTTTCACTTCATTTGGATGCCTGGACAATTTACTCTTGACCGTGATGGCCTAT
GACCGCTTCGTGGCCGTCTGTCACCCCCTGCACTATACGGTCATCATGAACCCCCAGCTC
TGTGGACTGCTGGTTCTGGGGTCCTGGTGCATCAGTGTCATGGGTTCCCTGCTCGAGACC
TTGACTGTTTTGAGGCTGTCCTTCTGCACCGAAATGGAAATTCCACACTTTTTTTGTGAT
CTACTTGAAGTCCTGAAGCTCGCCTGTTCTGACACCTTCATTAATAACGTGGTGATATAC
TTTGCAACTGGCGTCCTGGGTGTGATTTCCTTCACTGGAATATTTTTCTCTTACTATAAA
ATTGTTTTCTCTATACTGAGGATTTCCTCAGCTGGGAGAAAGCACAAAGCGTTTTCCACC
TGTGGTTCCCACCTCTCAGTGGTCACCTTGTTCTATGGCACGGGCTTTGGGGTCTATCTC
AGTTCTGCAGCCACACCATCTTCTAGGACAAGTCTGGTGGCCTCAGTGATGTACACCATG
GTCACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACACGGACATGAAGAGGGCC
CTGGGGAGACTCCTCAGTAGGGCAACATTTTTTAATGGTGACATCACTGCAGGACTTTCA
Conceptual translation METGNQTHAQEFLLLGFSATSEIQFILFGLFLSMYLVTFTGNLLIILAICSDSHLHTPMY
FFLSNLSFADLCFTSTTVPKMLLNILTQNKFITYAGCLSQIFFFTSFGCLDNLLLTVMAY
DRFVAVCHPLHYTVIMNPQLCGLLVLGSWCISVMGSLLETLTVLRLSFCTEMEIPHFFCD
LLEVLKLACSDTFINNVVIYFATGVLGVISFTGIFFSYYKIVFSILRISSAGRKHKAFST
CGSHLSVVTLFYGTGFGVYLSSAATPSSRTSLVASVMYTMVTPMLNPFIYSLRNTDMKRA
LGRLLSRATFFNGDITAGLS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 14,910,440 14,910,440 NS A/G I/T rs62122646 (DbSNP)
19 14,910,321 14,910,321 NS A/G S/P rs16979912 (DbSNP)
19 14,910,210 14,910,210 NS C/G V/L rs73004304 (DbSNP)
19 14,910,654 14,910,654 NS C/T G/S rs17230134 (DbSNP)
19 14,910,573 14,910,573 NS C/T V/I rs10415562 (DbSNP)
19 14,910,438 14,910,438 NS C/T E/K rs10415312 (DbSNP)
19 14,910,613 14,910,613 SYN A/G N/N rs60788745 (DbSNP)
19 14,799,842 14,799,842 NS T/C S/G 1000GP (CEU)
19 14,799,628 14,799,628 NS G/A T/I 1000GP (CEU)
19 14,799,761 14,799,761 NS C/T V/I 1000GP (CEU, CHBJPT)
19 14,799,626 14,799,626 NS C/T E/K 1000GP (CEU, CHBJPT)
19 14,799,398 14,799,398 NS C/G V/L 1000GP (CEU, CHBJPT)
19 14,799,509 14,799,509 NS A/G S/P 1000GP (CEU)
19 14,799,957 14,799,957 SYN G/A Y/Y 1000GP (CHBJPT)
19 100 -100 NS C/G V/L 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
19 100 -100 SYN A/G N/N 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L250W V247L R233K S210P L187F F177I E159K V126I S99G F17I % Freq CORP
1 L V R S L F E I S F 62.29 0.064
2 L V R S L F E V S F 16.97 0.064
3 L L R P L F E I G F 13.59 0.081
4 L V R P L F E I G F 2.23 0.064
5 L V K P L F K I S F 1.46 0.064
6 L V R P L F E I S F 1.38 0.064
7 L L R P L F E I G I 0.92 0.081
8 L V R P F F E I G F 0.38 0.066
9 L L R P L F E I S F 0.31 0.081
10 W V R P F F E I G F 0.15 0.066
11 L V R S L I E I S F 0.08 0.064
12 L V R S L F E I G F 0.08 0.064
13 L L R S L F E V S F 0.08 0.081
14 L V K P L F E I S F 0.08 0.064

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7A5andOR7C1.aApr07-unspliced main_exon 3UTR chr19 14,799,146 14,799,177 -
CDS chr19 14,799,177 14,800,136 -
5UTR chr19 14,800,136 14,800,211 -