Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7C2 Olfactory Receptor

Gene Symbol OR7C21 (View this gene in GeneCards)
Family 7
Subfamily C
Pseudogene No
CORP pseudogene probability score
Aliases CIT-HSP-87m17, OR19-18, OR19-22, HsOR19.3.11, ORL1029
External Ids HGNC: 8374   GeneBank: AF399545, BK004213, NM_012377, U86255   ORDB: ORL1029   
Build #39 labels OR7C2
Chromosomal location 19:14,941,489-14,942,445 (+)
Cluster 19@15a
Synteny CLIC#45
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs11883178)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7C1 77.81% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7C2 82% 308
Chimp CONTIG1211.37-8405 98% 320
Mouse Or7c70 72% 319
Rat Or7c70 73% 317
Cow OR7C2 76% 320

Expression evidences

Source Accession
mRNA AB463980
GNF Atlas2 208507_at

Sequence information

Nucleotide sequence ATGGAAAGAGGAAACCAAACAGAAGTTGGAAACTTTCTCCTCCTGGGATTCGCAGAGGAC
TCTGACATGCAGCTTCTCCTCCATGGGCTGTTCCTCTCCATGTACCTGGTTACCATCATC
GGAAACCTGCTCATCATCCTGACCATCAGTTCAGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCCTTTGCTGACATCTGTTTCACATCCACGACTGTCCCAAAG
ATGCTGGTGAATATCCAAACACAAAGCAAAATGATCACTTTTGCAGGCTGCCTCACTCAG
ATATTTTTTTTCATTGCATTTGGATGCCTGGACAATTTGCTCCTGACCATGACGGCCTAT
GACCGCTTCGTGGCCATCTGTTACCCCCTGCACTACACGGTCATCATGAACCCCCGGCTC
TGTGGACTGCTGGTTCTGGGGTCCTGGTGCATCAGTGTCATGGGTTCCTTGCTTGAGACC
TTGACCATTTTGAGGCTGTCCTTCTGCACAAATATGGAAATTCCGCACTTTTTTTGTGAT
CCTTCCGAAGTCCTGAAGCTGGCCTGTTCTGACACCTTCATCAATAACATCGTGATGTAT
TTTGTGACCATTGTCCTGGGTGTTTTTCCTCTCTGTGGAATCCTATTCTCTTATTCTCAG
ATTTTCTCCTCCGTCCTAAGAGTATCTGCCAGAGGCCAGCACAAAGCCTTTTCCACCTGT
GGTTCCCACCTCTCAGTGGTCAGCTTGTTCTATGGCACTGGCCTTGGGGTCTATCTCAGT
TCTGCAGTTACACCACCTTCTAGGACAAGTCTGGCAGCCTCGGTGATGTACACCATGGTC
ACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAAGGACATGAAGGGGTCACTG
GGGAGACTCCTCCTCAGGGCAACGTCTCTCAAAGAGGGGACCATTGCTAAGCTCTCA
Conceptual translation MERGNQTEVGNFLLLGFAEDSDMQLLLHGLFLSMYLVTIIGNLLIILTISSDSHLHTPMY
FFLSNLSFADICFTSTTVPKMLVNIQTQSKMITFAGCLTQIFFFIAFGCLDNLLLTMTAY
DRFVAICYPLHYTVIMNPRLCGLLVLGSWCISVMGSLLETLTILRLSFCTNMEIPHFFCD
PSEVLKLACSDTFINNIVMYFVTIVLGVFPLCGILFSYSQIFSSVLRVSARGQHKAFSTC
GSHLSVVSLFYGTGLGVYLSSAVTPPSRTSLAASVMYTMVTPMLNPFIYSLRNKDMKGSL
GRLLLRATSLKEGTIAKLS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS C/T T/M 1000GP (YRI, YRI, YRI)
19 100 -100 SYN C/G L/L 1000GP (YRI, YRI)
19 15,052,323 15,052,322 Ins(1) -/C rs34752297 (DbSNP)
19 15,052,653 15,052,653 NS C/T T/M rs8113325 (DbSNP)
19 15,052,665 15,052,665 NS A/G H/R rs11883178 (DbSNP)
19 15,052,738 15,052,737 Ins(1) -/G rs34305437 (DbSNP)
19 15,052,984 15,052,983 Ins(2) -/AT rs3044711 (DbSNP)
19 15,052,986 15,052,985 Ins(3) -/ATC rs72532311 (DbSNP)
19 15,052,987 15,052,986 Ins(3) -/ATC rs56204399 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 15,045,620 15,089,627 CopyNumber Variation_35611 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F94S T118M R122H I221T K294R % Freq CORP
1 F T R I K 94.55 0.254
2 F T H I R 3.76 0.858
3 F M R I R 0.84 0.078
4 F T R I R 0.38 0.254
5 S T R I K 0.23 0.254
6 F T R T K 0.15 0.254
7 F T H I K 0.08 0.858

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7C2.aApr07-unspliced main_exon CDS chr19 14,941,489 14,942,445 +
3UTR chr19 14,942,445 14,942,448 +