Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7D1P Olfactory Receptor

Gene Symbol OR7D1P1 (View this gene in GeneCards)
Family 7
Subfamily D
Pseudogene Yes
CORP pseudogene probability score
Aliases CIT-B-440L2, OR19-131, OR19-13, OR19-A, HsOR19.2.13P, ORL3777
External Ids HGNC: 8377   GeneBank: AB065577, AF399428, BK004547, NG_002212, U86251   ORDB: ORL3777   
Build #39 labels OR7D1P
Chromosomal location 19:9,235,144-9,236,076 (+)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7D4 90.03% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7D4 78% 311
Mouse Or7d9 75% 311
Rat Or7d9 74% 311
Cow OR7D2 66% 311
Orang OR7D4 90% 311
Orang OR4D4CP 90% 293
Horse OR7D4 78% 311
Chimp OR7D4B 94% 311
Chimp OR7D4 91% 311

Expression evidences

Source Accession
ESTs DB341718
mRNA BC141584
GNF Atlas2 gnf1h01869_at
GNF Atlas2 gnf1h01870_s_at
GNF Atlas2 gnf1h01871_x_at

Sequence information

Nucleotide sequence ATGGAAGCAGAAAACCTTACAGAATTATCAGAATTCCTCCTCTTAGGACTCTCAGATGAT
CCTGAACTGCAGCCCGTCCTCTTTGGGCTGTTCCTGTCCATGTACCTGGTCATGGTGCTG
GGGAACCTACTCATCATCCTGGCCGTCAGCTCTGACTCCCACCTCCACAGCCCCATGTAA
TTCTTCCTCTCCAACTTGTCCTTTGTGGACACCTGTTTCATCTGCACCACAGTCCCCAAG
ATGCTAGTGAACATCCAGGCACGGAGCAAAGACATCTCCTACATGGGGTGCCTCACTCAG
GTGTATTTTTAAATGATGTTTGCTGGAATGGATACTTTCCTACTGGCTGTGATAGCCTAT
GACCGGTTTGTGGCCATCTGCCACCCACTGCAGTACATGGTCATCATAAACCCCCATCTC
TGTGGCCTCCTGGTTCTGGCATCTTGGTTCATCATTTTCTGGTTCTCCCTGGTTCATATT
CTACTGATGAAGAGGCTGACCTTCTCCACAGGCACTGAGATTCCGCATTTCTTCTGTGAA
CTGGCTCAGGTCCTCAAGGTGGCCCGCTCTGATGCTCTCCTCATTAACATTGTCTTGTAT
GTGGCCATGGCACTGCTGGGTGTGTTTCCTGTAGCTGGGATCCTCTTCTCCTACTCTCAG
ATTGTCTCCTCCTTAATGAGAATGTCCTCCACCGAGGGCAAGTACAAAGCCTTTTCCACC
TGTGGATCTCACCTCTGTGTGGTCTCCTTGTTCTATGGAACAGGACTTGGGGTCTATCTC
AGTTCTGCTGTGACCCATTCTTCCCAGAGCAGCTCCATGGCCTCAGTGATGTACGCCATG
GTCACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAAGGATGTGAAGGGGGCC
CTGGGGAGACTCCTTAGCAGGGCAGCCTCTTGT
Conceptual translation MEAENLTELSEFLLLGLS\ILNCSP/LFGLFLSMYLVMVLGNLLIILAVSSDSHLHSP
MXFLSNLSFVDTCFICTTVPKMLVNIQARSKDISYMGCLTQVYFXMFAGMDTFLLAVI
AYDRFVAICHPLQYMVIINPHLCGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFF
CELAQVLKVARSDALLINIVLYVAMALLGVFPVAGILFSYSQIVSSLMRMSSTEGKYKAF
STCGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSMASVMYAMVTPMLNPFIYSLRNKDVK
GALGRLLSRAASC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,346,320 9,346,322 Del(3) -/CTT rs34854496 (DbSNP)
19 9,346,230 9,346,229 Ins(1) -/C rs34029269 (DbSNP)
19 9,346,513 9,346,513 SNP A/G rs61744462 (DbSNP)
19 9,346,173 9,346,173 SNP A/G rs3926919 (DbSNP)
19 9,345,964 9,345,964 SNP A/G rs73920711 (DbSNP)
19 9,346,130 9,346,130 SNP A/T rs1968135 (DbSNP)
19 9,346,599 9,346,599 SNP C/G rs1985937 (DbSNP)
19 9,346,482 9,346,482 SNP C/T rs2015121 (DbSNP)
19 9,346,167 9,346,167 SNP C/T rs3926918 (DbSNP)
19 9,346,427 9,346,427 SNP C/T rs1968136 (DbSNP)
19 9,235,379 9,235,379 SNP C/T 1000GP (CEU, CHBJPT)
19 9,235,923 9,235,923 SNP C/G 1000GP (CEU, CHBJPT)
19 9,235,727 9,235,727 SNP T/A 1000GP (CHBJPT)
19 9,235,837 9,235,837 SNP G/A 1000GP (CHBJPT)
19 100 -100 SNP A/G 1000GP (YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.