Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7D2 Olfactory Receptor

Gene Symbol OR7D21 (View this gene in GeneCards)
Family 7
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR19-10, OR19-4, HTPCRH03, HsOR19.2.8, ORL34, ORL1027
External Ids HGNC: 8378   GeneBank: AB065928, AF399537, BK004265, HSHTPRH03   ORDB: ORL34, ORL1027   
Build #39 labels OR7D2
Chromosomal location 19:9,185,782-9,186,717 (+)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7A10 67.11% 301
OR7D1P 68.49% 311
OR7D4 70.74% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7D2 89% 312
Chimp CONTIG875.18-631 98% 312
Mouse Or7a36 67% 305
Rat Or7a36 67% 305
Cow OR7D2 87% 312

Expression evidences

Source Accession
ESTs DA471386
mRNA AB463981
GNF Atlas2 gnf1h09473_at

Sequence information

Nucleotide sequence ATGGAAGCAGGAAACCAAACAGGATTTTTAGAGTTTATCCTTCTCGGACTCTCTGAGGAT
CCAGAACTACAGCCGTTCATATTTGGGCTGTTCCTGTCCATGTACCTGGTGACGGTGCTG
GGAAACCTGCTCATCATCCTGGCCATCAGCTCTGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCCTGGGTTGACATCTGTTTCAGCACTTGCATCGTCCCCAAG
ATGCTGGTGAACATCCAGACCGAGAACAAAGCCATCTCCTACATGGACTGCCTCACACAG
GTCTATTTCTCCATGTTTTTTCCTATTCTGGACACGCTACTCCTGACCGTGATGGCCTAT
GACCGGTTTGTGGCTGTCTGCCACCCTCTGCACTATATGATCATCATGAACCCCCACCTC
TGTGGCCTCCTGGTTTTTGTCACCTGGCTCATTGGTGTCATGACATCCCTCCTCCATATT
TCTCTGATGATGCATCTAATCTTCTGTAAAGATTTTGAAATTCCACATTTTTTCTGCGAA
CTGACGTACATCCTCCAGCTGGCCTGCTCTGATACCTTCCTGAACAGCACGTTGATATAC
TTTATGACGGGTGTGCTGGGCGTTTTTCCCCTCCTTGGGATCATTTTCTCTTATTCACGA
ATTGCTTCATCCATAAGGAAGATGTCCTCATCTGGGGGAAAACAAAAAGCACTTTCCACC
TGTGGGTCTCACCTCTCCGTCGTTTCTTTATTTTATGGGACAGGCATTGGGGTCCACTTC
ACTTCTGCGGTGACTCACTCTTCCCAGAAAATCTCCGTGGCCTCGGTGATGTACACTGTG
GTCACCCCCATGTTGAACCCCTTCATCTACAGCCTGAGGAACAAGGATGTGAAGGGAGCC
CTGGGGAGTCTCCTCAGCAGGGCAGCCTCTTGTTTG
Conceptual translation MEAGNQTGFLEFILLGLSEDPELQPFIFGLFLSMYLVTVLGNLLIILAISSDSHLHTPMY
FFLSNLSWVDICFSTCIVPKMLVNIQTENKAISYMDCLTQVYFSMFFPILDTLLLTVMAY
DRFVAVCHPLHYMIIMNPHLCGLLVFVTWLIGVMTSLLHISLMMHLIFCKDFEIPHFFCE
LTYILQLACSDTFLNSTLIYFMTGVLGVFPLLGIIFSYSRIASSIRKMSSSGGKQKALST
CGSHLSVVSLFYGTGIGVHFTSAVTHSSQKISVASVMYTVVTPMLNPFIYSLRNKDVKGA
LGSLLSRAASCL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,297,173 9,297,172 Ins(1) -/C rs35299432 (DbSNP)
19 9,297,196 9,297,196 NS A/G I/V rs61739064 (DbSNP)
19 9,297,047 9,297,047 NS C/T T/M rs13345452 (DbSNP)
19 9,297,381 9,297,381 SYN A/C A/A rs61733545 (DbSNP)
19 9,297,246 9,297,246 SYN A/G A/A rs61732227 (DbSNP)
19 9,297,273 9,297,273 SYN C/G S/S rs61732246 (DbSNP)
19 9,296,664 9,296,664 SYN C/T V/V rs56246934 (DbSNP)
19 9,297,078 9,297,078 SYN C/T G/G rs61743116 (DbSNP)
19 9,186,705 9,186,705 SYN A/C A/A 1000GP (CEU)
19 9,186,597 9,186,597 SYN C/G S/S 1000GP (CEU)
19 9,185,988 9,185,988 SYN T/C V/V 1000GP (CEU, CHBJPT)
19 9,186,610 9,186,610 NS A/T M/L 1000GP (CHBJPT)
19 100 -100 SYN T/C V/V 1000GP (YRI, YRI, YRI)
19 100 -100 NS G/A V/I 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
19 9,267,749 9,313,321 CopyNumber Variation_35700 (DGV)
19 9,271,324 9,311,170 CopyNumber Variation_35701 (DGV)
19 9,295,591 9,317,125 CopyNumber Variation_50243 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T197M V208I M277L % Freq CORP
1 T V M 95.79 0.078
2 T V L 2.45 0.078
3 M V M 1.36 0.078
4 T I M 0.41 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7D2.aApr07-unspliced main_exon 5UTR chr19 9,185,595 9,185,782 +
CDS chr19 9,185,782 9,186,717 +
3UTR chr19 9,186,717 9,188,817 +