Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E100P Olfactory Receptor

Gene Symbol OR7E100P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR3.4.1P, ORL3116
External Ids HGNC: 15048   GeneBank: NG_004266   ORDB: ORL3116   
Build #39 labels OR7E100P
Chromosomal location 3:112,524,186-112,525,200 (-)
Cluster 3@112
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E102P 90.03% 331
OR7E111P 90.21% 327
OR7E22P 85.76% 337

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 73% 315
Chimp CONTIG*********** 98% 339
Mouse Or7e178 68% 308
Rat Or7e176b 66% 294
Cow OR7E186 72% 305

Expression evidences

Source Accession
ESTs GD256858

Sequence information

Nucleotide sequence ATTTTTCCAATCCTCTTTTCTTCTCAAAAAAAGAGGTGTCCAAGTCACACAGAGCCATAG
AATCTCACAAGTGTCTCAGAATTCCTTCTCCAGGGACTCTCAGAGGATCCAGAACTGCAG
CCCGTCCTCGCTGGGCTGTCCCTGTCCATGTACCTGGTCACGGTGCTGAGGAACCTGCTC
ATCATCCTGGCTGTCAGCTCTGACTCCCACCTCCACACCCCCATGTACTTCTTCCTCTCC
AACCTCTCCTGGGCTGACATTGGTTTCACCTCGGCCATGGTTCCCAAGATGATTGTGGAC
ATGCAGTCGCATAGCAGAGTCATCTCTTAAGCGGGCTGCCTGACACAGATGTCTTTCTTT
GTCCTTTTTGCATGTATAGAAGACATGCTCCTGACTGTGATGGCCTATGACCAATTTGTG
GCCATCTGTCACCCCTGCACTACCCAGTCATCATGAATCCTCACCTCTGTGTCTTCTTAG
TTTTGGTTTCTTTTTTCCTTAGCCTGTTGGATTCCCAGCTGCACAGTTGGATTGTGTTAC
AATTCACCTTCTTCAAGAATGTGGAAATCTCTAATTTTTTCTGTGATCCATCTCAACTTC
TCAACCTTGCCTGTTCTGACGGCATCATCAATAGCATATTTATATATTTAGATAGTATTC
TGTTCAGTTTTCTTCCCATTTCAGGGATCCTTTTGTCTTACTATAAAATTGTCCCCTCCA
TTCTAAGAATTTCATCGTCAGATGGGAAGTATAAAGCCTTCTCCATCTGTGGCTCTCACC
TGGCAGTTGTTTGCTTATTTTATGGAACAGGCATTGGCGTGTACCTAACTTCAGCTGTGT
vvCACCACCCCCAGGAATGGTGTGGTGGCGTCAGTGATGTATGCTGTGGGCACCCCCATG
CTGAACTCTTTTATCTACAGCCTGAGAAACAGGGACATTCAAAGCGCCCTGTGGAGGCTG
CGCAGCAGAACAGTCGAATCTCATGATCTGTTCCATCCTTATTCTTGTGTGGGTAAG
Conceptual translation IFPILFSSQKKRCPSHTEPXLTSVSEFLLQGLSEDPELQPVLAGLSLSMYLVTVLRNLL
IILAVSSDSHLHTPMYFFLSNLSWADIGFTSAMVPKMIVDMQSHSRVISXGCLTQMSFF
VLFACIEDMLLTVMAYDQFVAIC/PLHYPVIMNPHLCVFLVLVSFFLSLLDSQLHSWIV
LQFTFFKNVEISNFFCDPSQLLNLACSDGIINSIFIYLDSILFSFLPISGILLSYYKIVP
SILRISSSDGKYKAFSICGSHLAVVCLFYGTGIGVYLTSAVSPPP/NGVVASVMYAVGT
PMLNSFIYSLRNRDIQSALWRLRSRTVESHDLFHPYSCVGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 112,243,229 112,243,229 SNP C/T rs7615899 (DbSNP)
3 112,243,924 112,243,924 SNP C/T rs6772077 (DbSNP)
3 112,243,635 112,243,635 SNP T/C rs2933141 (DbSNP)
3 112,524,788 112,524,788 SNP T/C 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
3 112,243,739 112,243,963 Del(-16) #3(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
ATG3andOR7E100P.jApr07 main_exon CDS_partial chr3 112,525,062 112,525,167 -
exon_5UTR chr3 112,530,275 112,530,394 -
exon_5UTR chr3 112,536,475 112,536,893 -