Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E106P Olfactory Receptor

Gene Symbol OR7E106P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR14-NP2, OST215, HsOR14.5.2P, ORL3708
External Ids HGNC: 15365   GeneBank: AF399387, BK004810, NG_004170   ORDB: ORL3708   
Build #39 labels OR7E106P, OR7E40P
Chromosomal location 14:51,763,094-51,764,040 (-)
Cluster 14@52
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E33P 89.21% 315
OR7E36P 89.27% 317
OR7E37P 89.87% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 68% 315
Chimp CONTIG12568.3-965 95% 316
Mouse Or7e178 65% 305
Rat Or7e177 64% 294
Cow OR7E188 69% 292

Expression evidences

Source Accession
ESTs BG186361

Sequence information

Nucleotide sequence TGTCCAATCTCTAGAGACCCACAGAATCTAACAGATGTCTCTATATTCCTCCTCCTAGAA
GCTCAGAGGATCCAGAACGGCAGCCGGTCCTCACTGGGCTGTTCCTGTCCACGTGCCTGG
TCATGGCGCTGGGGAACCTGCTCATCATCCTGGCCATCAGCCCTGACTCCCACCTCCACA
CCCCCATGTACTTCTTCCTCTCCAACCTGTCCTTGCCTGACATCAGTTTCACCTCCACCA
CAGTCCCCAAGATGACTGTGGACATCCAATCTCACAGCAGAGTCATCTCCTATGCAGGCT
GCCTGACTCAGATGTCTCTCTTTGCCATTTTTGGAGGCATGGAAGACAGACATACTCCTG
AGTGTGATGGCCTATGACCAGTTTGTAGCCAAATGTCACCCTCTATATCATTCAGCCATC
ATGAACCCGTGTTTCTGTGGCTTTCTACTTTTGTTGTCTTTTTTTTTTCCCTCAGTCTTT
TAGATGCCCAGCTGTACAATTTGATTGCCTTACAAATGACCTGCTTCAAGGATGTGGAAA
TTCCTAATTTCTTCTGTGACCCTTCTCAACTCCCCCATCTTGCATGTTGTGACACCTTCA
ACAATAACATAATCCTGTATTTCCCTGATGCCATATTTGGTTTTCTTCCCATCTCGGGGA
CACTTTTCTCTTACGATAAAATTGTTTCCTCCATTCTGAGGGTTTCATCATCAGGTGGGA
AGTATAAAGCCTTCTCCACCTATGGGTCTCACCTGTCAGATGTTTCCTGATTTTATGGAA
CAGGCGTTGGAGGGTACCTCAGTTCAGATGTGTCATCTTCCCCGAGAAAGACTGCAGTGG
CCTCAGTGATGTACGCAGTGGTCACCCCCATGATGAACCCCTTCATCTACAGTCCGAGAA
ACAGGGATATGAAAAGTGTCCTGCGGCGGCCGCACGGCAGCACGTTC
Conceptual translation CPISRDPQNLTDVSIFLLLE/SEDPERQPVLTGLFLSTCLVMALGNLLIILAISPDSHL
HTPMYFFLSNLSLPDISFTSTTVPKMTVDIQSHSRVISYAGCLTQMSLFAIFGGME\DI
LLSVMAYDQFVAKCHPLYHSAIMNPCFCGFLLLLSFFF/LSLLDAQLYNLIALQMTCFK
DVEIPNFFCDPSQLPHLACCDTFNNNIILYFPDAIFGFLPISGTLFSYDKIVSSILRVSS
SGGKYKAFSTYGSHLSDVSXYGTGVGGYLSSDVSSSPRKTAVASVMYAVVTPMMNPFIY
SPRNRDMKSVLRRPHGSTF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 SNP C/T 1000GP (YRI, YRI, YRI)
14 51,763,186 51,763,186 SNP C/T 1000GP (CEU, CHBJPT)
14 51,763,440 51,763,440 SNP T/G 1000GP (CEU)
14 51,763,644 51,763,644 SNP G/A 1000GP (CEU, CHBJPT)
14 52,229,904 52,229,904 SNP C/T rs57839902 (DbSNP)
14 52,230,001 52,230,001 SNP C/T rs59231473 (DbSNP)
14 52,230,158 52,230,158 SNP G/T rs56825043 (DbSNP)
14 52,230,341 52,230,341 SNP C/T rs4414400 (DbSNP)
14 52,230,359 52,230,359 SNP C/G rs34701364 (DbSNP)
14 52,230,362 52,230,362 SNP A/G rs12885717 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 218 (Hasin)
14 52,212,766 52,246,833 CopyNumber Variation_71900 (DGV)
14 52,215,384 52,239,627 CopyNumber Variation_87223 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7E106P.aApr07-unspliced main_exon CDS_partial chr14 51,763,767 51,763,961 -