Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E108P Olfactory Receptor

Gene Symbol OR7E108P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR9.3.2P, ORL325
External Ids HGNC: 15117   GeneBank: AF399420, NG_004254   ORDB: ORL325   
Build #39 labels OR7E108P
Chromosomal location 9:90,751,218-90,752,240 (-)
Cluster 9@94
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E116P 93.57% 342
OR7E4P 89.71% 340
OR7E91P 88.3% 342

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 69% 329
Mouse Or7e178 66% 308
Rat Or7e173 62% 308
Cow OR7E186 65% 327
Orang OR7E111CP 85% 317
Orang OR7E100P 85% 315
Horse OR7E225 67% 322
Chimp OR7E115P 87% 318
Chimp OR7E4P 89% 297

Sequence information

Nucleotide sequence CTGGTTTTTATCTTTTATTTTTCCAATCCTCTTTTCTTCCCAAGGTGTCCAAGTCACACA
GAGCCACGGCATCTCACAGGTGTCTGAGAATTCCTCCTCCTGGGACTCTCAGAGGATCCA
GAACTGCAGCCTGTCCTCGCTGGGCTGTCCCCATCCATGTATCTGGTCACAGTGCTGAGG
AACCTGCTCGTCATCCTGGCTGTCAGCTCTGACTCCCACCTCCACACCCCCATGTACTTC
TTCCTCTCCAACCCGTGCTGGGCTGACATCGGTTTCACTTCGGCCACGGTTCCCAAGATG
ACTGTGGACATGCAGTCACATATCAGAGTCATCTCTTATGCGAGCTGCCTGACACGGATG
TCTTTCTTGGTCCTTTTTGCATGTATAGAAGACATGCTCCTGACTGTGATGGCCTAGGAC
TGCTTTGTAGCCATCTGTCGCCCTCTGCACTACGCAGTCATCGTGAATCCTCACCTCTGT
GTCTTCTTAGTTTTGGTGTCCTTTTTCCTTAGCCTGTTGGATTCCCAGCTGCACAGTTAG
ATTGTTACAATTCACCTTCTTCAAGAATGTGGAAATCTCTCATTTTGTCTGTGAGCCATC
TCAACTTCTCAACCTTGCCTGTTCTGACAGCGTCATCAATAGCATATTCATGTATTTCAA
TAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGATCCTTTTGTCTTACTATAAAATTGT
TCCCTCCATTCTAAGGATTTCATCGTCAGATGGGAAGTATAAAGCCTTCTCCACCTGTGG
CTCTCACCTGGCAGTTGTTTGCTTATTTTATGGAACAGGCATTGGCATGTACCTGACTTC
AGCTGTGGCACCACCCCCCAGGAATGGTGTGGTGGCGTCAGTGATGTACGCTGTGGTCAC
CCCCATGCTGAACCCTTTCATCTACAGCCTGAGAAACAGGGACATTCAAAGCGCCCTGTG
GAGGCTGCGCAGCAGAACAGTCGAATCTCATGATCTGTTCCATCCTTTTTCTTGTGTGGG
TAAG
Conceptual translation LVFIFYFSNPLFFPRCPSHTEPRHLTGVXFLLLGLSEDPELQPVLAGLSPSMYLVTVLR
NLLVILAVSSDSHLHTPMYFFLSNPCWADIGFTSATVPKMTVDMQSHIRVISYASCLTRM
SFLVLFACIEDMLLTVMAXCFVAICRPLHYAVIVNPHLCVFLVLVSFFLSLLDSQLH/
L/LLQFTFFKNVEISHFVCEPSQLLNLACSDSVINSIFMYFNSTMFGFLPISGILLSYY
KIVPSILRISSSDGKYKAFSTCGSHLAVVCLFYGTGIGMYLTSAVAPPPRNGVVASVMYA
VVTPMLNPFIYSLRNRDIQSALWRLRSRTVESHDLFHPFSCVGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 90,751,960 90,751,960 SNP G/A 1000GP (CEU)
9 93,513,529 93,513,529 SNP C/G rs58830793 (DbSNP)
9 93,513,724 93,513,725 Del(2) -/AA rs34170086 (DbSNP)
9 93,513,727 93,513,727 Del(1) -/C rs34140480 (DbSNP)
9 93,513,728 93,513,730 Del(3) -/AAC rs57598411 (DbSNP)
9 93,513,768 93,513,768 Del(1) -/T rs56130415 (DbSNP)
9 93,514,242 93,514,242 SNP A/G rs12380216 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.