Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E109P Olfactory Receptor

Gene Symbol OR7E109P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR9.3.1P, ORL325
External Ids HGNC: 15118   GeneBank: AF399394, NG_004386   ORDB: ORL325   
Build #39 labels OR7E109P
Chromosomal location 9:90,742,502-90,743,448 (-)
Cluster 9@94
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E31P 94.62% 316
OR7E33P 92.41% 316
OR7E46P 92.09% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E153 73% 311
Mouse Or7e178 68% 311
Rat Or7e173 66% 307
Cow OR7E186 72% 307
Orang OR7E15P 90% 316
Orang OR7E14P 87% 316
Orang OR7E31DP 91% 297
Horse OR7E225 72% 311
Chimp OR7E31P 93% 316
Chimp OR7E36P 91% 318

Expression evidences

Source Accession
ESTs BG187898

Sequence information

Nucleotide sequence TGTCCAATCTCTACAGACCCACAGAATCTAATAGATGTCTCTATATTCCTCCTCCTAGAA
CCTCAGAGGATCCAGAACGGCAGCTGGTCCTTGCTGGGCTGTTCCTGTCCATGTGCCTGG
TCACGGTGCTGGGGAACCTGCTCATCATCCTGGCCGTCAGTCCTGACTCCCACCTCCACA
CCCCCATGTACTTCTTCCTCTCCAACCTATCCTTGCCTGACATCGGTTTCACCTCCACCA
CGGTCCCCAAGATGATTGTGGACATCCGATCTCACAGCAGAGTCATCTCCTATGCAGGCT
GCCTGACTCAGACATCTCTCTTTGCCATTTTTGGAGGCATGGAAGAGAGACATGCTCCTG
AGTGTGATGGCCTATGACCAGTTTGTAGCCATCTGTCACCCTCTATATCATTCAGCCGTC
ATGAACCCTTGTTTCTGTGGCTTTCTAGTTTTGTTGACTTTTTTTTTTTTCTCAGTCTTT
TAGACGCCCAGCTGCACAACTTGATTGCCTTACAAATGACCTGCTTCAAGGATGTGGAAA
TTCCTAATTTCTTCTGTGACCCTTCTCCACTCCCCCATCTTGCATGTTGTGACACCTTCA
CCAATAACATAATCATGTATTTCCCTGCTGCCATATTTGGTTTTCTTCCCATCTCGGGGA
CCCTTTTCTCTTACTATAAAATTGTTTCCTCCATTCTGAGGGTTTCATCATCAGGTGGGA
AGTATAAGGCCTTCTCCACCTGTGGGTCTCACCTGTCGGTTGTTTGCTGATTTTATGGAA
CAGGCATTGGAGGGTACCTCAGTTCAGATGTGTCATCTTCCCCGAGAAAGGCTGCGGTGG
CCTCAGTGATGTACACGGTGGTCACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGAA
ACAGGGATATTAAAAGTGTCCTGCGGTGGCTGCACGGCAGCTCTGTC
Conceptual translation CPISTDPQNLIDVSIFLLLE/SEDPERQLVLAGLFLSMCLVTVLGNLLIILAVSPDSHL
HTPMYFFLSNLSLPDIGFTSTTVPKMIVDIRSHSRVISYAGCLTQTSLFAIFGGMEE\M
LLSVMAYDQFVAICHPLYHSAVMNPCFCGFLVLL/FFFFLSLLDAQLHNLIALQMTCFK
DVEIPNFFCDPSPLPHLACCDTFTNNIIMYFPAAIFGFLPISGTLFSYYKIVSSILRVSS
SGGKYKAFSTCGSHLSVVCXYGTGIGGYLSSDVSSSPRKAAVASVMYTVVTPMLNPFIY
SLRNRDIKSVLRWLHGSSV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 SNP G/A 1000GP (YRI, YRI)
9 90,742,992 90,742,992 SNP T/A 1000GP (CEU)
9 93,504,950 93,504,950 SNP G/A rs1148849 (DbSNP)
9 93,505,098 93,505,098 SNP T/C rs1054451 (DbSNP)
9 93,505,104 93,505,104 SNP T/C rs1054450 (DbSNP)
9 93,505,232 93,505,232 SNP C/T rs36100897 (DbSNP)
9 93,505,413 93,505,413 SNP A/G rs10821494 (DbSNP)
9 93,505,417 93,505,417 SNP C/T rs1148850 (DbSNP)
9 93,505,442 93,505,442 SNP A/G rs3956147 (DbSNP)
9 93,505,463 93,505,463 SNP C/T rs3956148 (DbSNP)
9 93,505,508 93,505,508 In-Del(1) -/G rs72508126 (DbSNP)
9 93,505,522 93,505,522 SNP C/T rs4002858 (DbSNP)
9 93,505,570 93,505,570 SNP A/G rs4002859 (DbSNP)
9 93,505,575 93,505,575 SNP C/T rs10481712 (DbSNP)
9 93,505,590 93,505,590 SNP G/T rs3956149 (DbSNP)
9 93,505,707 93,505,707 SNP C/G rs12156627 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 93,502,784 93,505,830 CopyNumber #46 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7E109P.aApr07-unspliced main_exon CDS_partial chr9 90,742,826 90,743,372 -